(data stored in ACNUC7421 zone)

EMBL: CP000948.REND

CP000948.REND        Location/Qualifiers
FT   CDS_pept        506617..506802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="renD"
FT                   /locus_tag="ECDH10B_0498"
FT                   /product="DLP12 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01665"
FT                   /protein_id="ACB01665.1"
FT                   /translation="MARAGILVVDGKVWRTVYYRFATREEWEGKVSTNLIFKECRQSAA
FT                   MKRVLRVYKRTSMGTQ"
     atggcgcggg caggaatcct ggtcgttgat ggtaaggtct ggcgaacggt gtattaccgg        60
     ttcgctacca gagaagaatg ggaaggaaag gtgagcacga atctgatttt taaggagtgt       120
     cgccagagtg ccgcgatgaa acgggtattg agggtatata aaagaacatc aatgggaaca       180
     caatga                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page