(data stored in ACNUC7421 zone)

EMBL: CP000948.RHSC

CP000948.RHSC        Location/Qualifiers
FT   CDS_pept        781398..785591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhsC"
FT                   /locus_tag="ECDH10B_0767"
FT                   /product="rhsC element core protein RhsC"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01910"
FT                   /protein_id="ACB01910.1"
FT                   /translation="MSGKPAARQGDMTQYGGSIVQGSAGVRIGAPTGVACSVCPGGVTS
FT                   GHPVNPLLGAKVLPGETDIALPGPLPFILSRTYSSYRTKTPAPVGSLGPGWKMPADIRL
FT                   QLRDNTLILSDNGGRSLYFEHLFPGEDGYSRSESLWLVRGGVAKLDEGHRLAALWQALP
FT                   EELRLSPHRYLATNSPQGPWWLLGWCERVPEADEVLPAPLPPYRVLTGLVDRFGRTQTF
FT                   HREAAGEFSGEITGVTDGAGRHFRLVLTTQAQRAEEARQQAISGGTEPSAFPDTLPGYT
FT                   EYGRDNGIRLSAVWLTHDPEYPENLPAAPLVRYGWTPRGELAAVYDRSNTQVRSFTYDD
FT                   KYRGRMVAHRHTGRPEICYRYDSDGRVTEQLNPAGLSYTYQYEKDRITITDSLNRREVL
FT                   HTQGEGGLKRVVKKEHADGSVTQSQFDAVGRLRAQTDAAGRTTEYSPDVVTGLITRITT
FT                   PDGRASAFYYNHHSQLTSATGPDGLEIRREYDEWGRLIQETAPDGDITRYRYDNPHSDL
FT                   PCATEDATGSRKTMTWSRYGQLLSFTDCSGYVTRYDHDRFGQVTAVHREEGLSQYRAYD
FT                   SRGQLIAVKDTQGHETRYEYNAAGDLTTVIAPDGSRNGTQYDAWGKAICTTQGGLTRSM
FT                   EYDAAGRVIRLTSENGSHTTFRYDVLDRLIQETGFDGRTQRYHHDLTGKLIRSEDEGLV
FT                   THWHYDEADRLTHRTVNGETAERWQYDERGWLTDISHISEGHRVTVHYGYDSKGRLASE
FT                   HLTVHHPQTNELLWQHETRHAYNAQGLANRCIPDSLPAVEWLTYGSGWLSGMKLGDTPL
FT                   VEYTRDRLHRETLRSFGRYELTTAYTPAGQLQSQHLNSLLSDRDYTWNDNGELIRISSP
FT                   RQTRSYSYSTTGRLTGVHTTAANLDIRIPYTTDPAGNRLPDPELHPDSALSMWPDNRIA
FT                   RDAHYLYRYDRHGRLTEKTDLIPEGVIRTDDERTHRYHYDSQHRLVHYTRTQYAEPLVE
FT                   SRYLYDPLGRRVAKRVWRRERDLTGWMSLSRKPQVTWYGWDGDRLTTIQNDRTRIQTIY
FT                   QPGSFTPLIRVETATGELAKTQRRSLADTLQQSGGEDGGSVVFPPVLVQMLDRLESEIL
FT                   ADRVSEESRRWLASCGLTVAQMQSQMDPVYTPARKIHLYHCDHRGLPLALISTEGTTAW
FT                   YAEYDEWGNLLNEENPHQLQQLIRLPGQQYDEESGLYYNRHRYYDPLQGRYITQDPIGL
FT                   KGGWNFYQYPLNPISNIDPLGLETLKCIKPLHSMGGTGERSGPDIWGNPFYHQYLCVPD
FT                   GKGDYTCGGQDQRGESKGDGLWGPGKASNDTKEAAGRCDLVETDNSCVENCLKGKFKEV
FT                   RPRYSVLPDIFTPINLGLFKNCQDWSNDSLETCKMKCSGNNIGRFIRFVFTGVM"
     atgagcggaa aaccggcggc gcgtcagggc gacatgacgc agtatggcgg tagcattgtc        60
     cagggttcag ccggggtacg catcggtgcc cccaccggcg tggcctgttc ggtgtgcccc       120
     ggcggggtga cgtccggcca tccggtcaat ccgctgctcg gtgcaaaggt ccttcccggt       180
     gaaaccgaca tcgccctgcc cggcccgctg ccgttcattc tctcccgcac ctacagcagt       240
     taccggacaa aaacgcccgc gccggtgggg agcctcggcc ccggctggaa aatgcctgcg       300
     gatatccgct tacagctgcg cgataacaca ctgatactca gtgataacgg cggcagaagc       360
     ctgtattttg agcacctgtt tcccggtgag gacggttaca gccgcagcga gtcactgtgg       420
     ctggtgcgcg gcggcgtggc gaaactggat gaaggtcacc ggctggccgc actctggcag       480
     gcgctgccgg aagaactccg cttaagtccg catcgttatc tggcgacaaa cagtccgcag       540
     gggccgtggt ggctgctcgg ctggtgtgag cgggtgccgg aagcggatga ggtgctgcct       600
     gcgccgctgc cgccgtaccg ggtactgacc gggctggtgg accgcttcgg gcgcacacag       660
     acgttccacc gcgaagccgc cggtgaattc agcggcgaaa tcaccggcgt gacggatggt       720
     gccgggcgtc acttccggct ggtactgacc acgcaggcgc agcgggcaga agaagcccgg       780
     cagcaggcca tttccggcgg gacggaaccg tccgcttttc ctgataccct gccgggttac       840
     accgaatatg gccgggacaa cggcatccgt ctgtctgccg tgtggctgac gcacgacccg       900
     gaatacccgg agaatttacc tgccgcgccg ctggtgcgct atggctggac gccccgcggc       960
     gaactggcgg cggtgtatga ccgcagcaat acacaggtgc gcagctttac ttacgatgat      1020
     aaataccggg gccggatggt ggcgcaccgt cacacgggcc gaccggaaat ctgttaccgt      1080
     tacgacagcg acgggcgggt gacagaacag ctaaacccgg caggcttaag ttacacgtat      1140
     cagtatgaga aggaccgcat caccatcacc gacagcctga accgccgtga agtcctgcac      1200
     acgcagggtg aaggcgggct gaagcgggtg gtgaaaaagg aacacgcgga cggcagcgtc      1260
     acgcagagtc agtttgacgc ggtgggcagg ctcagggcac agacggatgc cgcaggcagg      1320
     acaacagaat acagtccgga tgtggtgacg ggcctcatca cgcgcatcac cacgccggat      1380
     ggcagggcat cggcgtttta ctataaccac cacagccagt taacgtcagc caccgggcct      1440
     gacgggctgg aaatacgccg ggaatatgat gaatggggcc gtctgattca ggaaactgcc      1500
     cctgacggcg atatcacccg ctaccgttat gataatccac acagtgactt accctgcgca      1560
     acggaagatg ccaccggcag ccggaaaacc atgacgtgga gccgttacgg tcagttgctg      1620
     agcttcactg actgttccgg ttatgtaacc cgctatgacc atgaccgttt tggtcaggtg      1680
     acggcggtgc accgcgagga agggctgagt cagtaccgcg catacgacag ccgtggacag      1740
     ttaattgccg tgaaagacac gcagggccat gaaacgcggt atgaatacaa cgccgccggt      1800
     gacctgacca ccgtcattgc cccggacggc agcagaaacg ggacacagta cgatgcgtgg      1860
     ggaaaagcca tctgtaccac gcagggcggt ctgacgcgca gtatggaata cgatgctgcc      1920
     ggacgggtca tccgcctgac cagtgaaaac ggcagccaca ccaccttccg ttacgatgta      1980
     ctcgaccggc tgatacagga aaccggcttt gacggccgca cacagcgtta tcaccacgac      2040
     ctgaccggca aacttatccg cagcgaggat gaggggctgg tcacccactg gcactatgac      2100
     gaagcagacc gcctcacgca ccgcaccgtg aatggcgaaa ccgcagagcg gtggcagtat      2160
     gacgaacgcg gctggctgac agacatcagc catatcagcg aagggcaccg ggtgacggtg      2220
     cactatggtt atgacagtaa aggccgcctc gccagtgaac acctgacggt gcatcatccg      2280
     cagacgaatg aactgctctg gcagcatgag accagacatg cgtacaacgc acagggactg      2340
     gcgaaccgct gtataccgga cagcctgccc gccgtggaat ggctgaccta cggcagcggc      2400
     tggctgtcag gcatgaaact cggcgacaca ccgctggtgg agtacacccg cgaccgcctg      2460
     caccgggaaa cgctgcgcag cttcggccgt tatgaactca ccaccgctta tacccctgcc      2520
     gggcagttac agagccagca cctgaacagc ctgctgtctg accgcgatta cacctggaac      2580
     gacaacggcg aactcatccg catcagcagc ccgcgccaga cccggagtta cagctacagc      2640
     accaccggca ggctgaccgg cgttcacacc accgcagcga atctggatat ccgcatcccg      2700
     tataccacag acccggcagg taaccgcctg cccgacccgg agctgcaccc ggacagcgcc      2760
     ctcagcatgt ggccggataa ccgtatcgcc cgtgacgcgc actatcttta ccggtatgac      2820
     cgtcacggca ggctgacaga gaaaaccgac ctcatcccgg aaggggttat ccgcacggat      2880
     gatgagcgca cccaccggta ccattacgac agtcagcacc ggctggtgca ctacacgcgg      2940
     acacaatatg cagagccgct ggtcgaaagt cgctatcttt acgacccgct gggccgcagg      3000
     gtggcaaaac gggtatggcg gcgtgaacgg gacctgacgg gctggatgtc gctgtcacgg      3060
     aaaccgcaag tgacctggta cggctgggac ggcgaccgcc tgaccacgat acagaacgac      3120
     agaacccgca tccagacgat ttatcagccg gggagcttca cgccactcat cagggttgaa      3180
     accgccaccg gtgagctggc gaaaacgcag cgccgcagcc tggcggatac ccttcagcag      3240
     tccggtggcg aagacggtgg cagtgtggtg ttcccgccgg tgctggtgca gatgctcgac      3300
     cggctggaaa gtgaaatcct ggctgaccgg gtgagtgagg aaagccgccg ctggctggca      3360
     tcgtgcggcc tgacggtggc gcagatgcaa agccagatgg acccggtata cacgccggcg      3420
     cgaaaaattc acctgtacca ctgcgaccat cgcggcctgc cgctggccct tatcagcacg      3480
     gaagggacaa cagcgtggta cgcagaatac gatgaatggg gtaacctgct gaatgaagag      3540
     aacccgcatc agctgcagca gcttatccgc ctgccggggc agcagtatga tgaggagtcc      3600
     ggcctgtatt acaaccgcca ccgctattat gacccgctgc aggggcgata tatcactcag      3660
     gatccgattg ggctgaaagg gggatggaat ttttatcagt atccgttgaa tccgatctca      3720
     aatatagatc cattaggatt agaaacacta aaatgcatta agccactgca ttcaatgggc      3780
     ggaactggtg aaagaagcgg tccagatata tgggggaatc cgttctatca tcaatatctt      3840
     tgtgtcccag atggtaaagg ggactatact tgtggtggcc aagaccaacg gggagaatca      3900
     aaaggagatg gtctatgggg gccaggtaaa gcaagtaatg atacaaaaga agctgctggc      3960
     cgttgtgacc tcgttgaaac cgataatagt tgtgtggaga actgtttaaa agggaagttt      4020
     aaagaggtaa ggccgcgtta ttctgtattg cctgatatat tcacacctat aaatttaggg      4080
     ctatttaaaa actgccaaga ctggtctaat gattctttag aaacatgtaa gatgaagtgc      4140
     tccggaaata acattggacg ttttattaga tttgtattca ccggagtgat gtaa            4194
//

If you have problems or comments...

PBIL Back to PBIL home page