(data stored in ACNUC7421 zone)

EMBL: CP000948.RNK

CP000948.RNK         Location/Qualifiers
FT   CDS_pept        complement(582112..582522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnk"
FT                   /locus_tag="ECDH10B_0570"
FT                   /product="regulator of nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01733"
FT                   /protein_id="ACB01733.1"
FT                   /translation="MSRPTIIINDLDAERIDILLEQPAYAGLPIADALNAELDRAQMCS
FT                   PEEMPHDVVTMNSRVKFRNLSDGEVRVRTLVYPAKMTDSNTQLSVMAPVGAALLGLRVG
FT                   DSIHWELPGGVATHLEVLELEYQPEAAGDYLL"
     atgtccagac caactatcat cattaacgac ctggatgccg aacgcatcga tattctgctg        60
     gagcaacccg cctatgctgg tttgccaatc gccgacgcgt taaacgcaga gttggatcgc       120
     gcccaaatgt gttcgccaga agagatgcca cacgacgtgg tgacaatgaa cagccgggtt       180
     aaattccgca atcttagcga tggcgaagtg cgtgtgcgca cgctggtgta tccggcaaaa       240
     atgaccgata gcaatactca gctttccgtt atggctccgg taggtgccgc actgctgggg       300
     ctgcgcgttg gcgattccat tcactgggaa cttccgggcg gcgttgcaac ccaccttgaa       360
     gtgctggaac tcgaatacca gccagaagct gctggcgact acctgcttta a                411
//

If you have problems or comments...

PBIL Back to PBIL home page