(data stored in ACNUC7421 zone)

EMBL: CP000948.RPST

CP000948.RPST        Location/Qualifiers
FT   CDS_pept        complement(20815..21078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="ECDH10B_0024"
FT                   /product="30S ribosomal subunit protein S20"
FT                   /note="The sequence ambiguity (R) at residue 183 of this
FT                   gene may represent a mixed population, but the change is
FT                   synonymous (CAA and CAG both encode Q)"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01228"
FT                   /db_xref="GOA:B1XBE8"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XBE8"
FT                   /protein_id="ACB01228.1"
FT                   /translation="MANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKA
FT                   AAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
     ttggctaata tcaaatcagc taagaagcgc gccattcagt ctgaaaaggc tcgtaagcac        60
     aacgcaagcc gtcgctctat gatgcgtact ttcatcaaga aagtatacgc agctatcgaa       120
     gctggcgaca aagctgctgc acagaaagca tttaacgaaa tgcaaccgat cgtggaccgt       180
     cargctgcta aaggtctgat ccacaaaaac aaagctgcac gtcataaggc taacctgact       240
     gcacagatca acaaactggc ttaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page