(data stored in ACNUC7421 zone)

EMBL: CP000948.SDHB

CP000948.SDHB        Location/Qualifiers
FT   CDS_pept        809504..810220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="ECDH10B_0791"
FT                   /product="succinate dehydrogenase, FeS subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01933"
FT                   /protein_id="ACB01933.1"
FT                   /translation="MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEK
FT                   DPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLV
FT                   VDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFW
FT                   WNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNP
FT                   TRAIGHIKSMLLQRNA"
     atgagactcg agttttcaat ttatcgctat aacccggatg ttgatgatgc tccgcgtatg        60
     caggattaca ccctggaagc ggatgaaggt cgcgacatga tgctgctgga tgcgcttatc       120
     cagctaaaag agaaagatcc cagcctgtcg ttccgccgct cctgccgtga aggtgtgtgc       180
     ggttccgacg gtctgaacat gaacggcaag aatggtctgg cctgtattac cccgatttcg       240
     gcactcaacc agccgggcaa gaagattgtg attcgcccgc tgccaggttt accggtgatc       300
     cgcgatttgg tggtagacat gggacaattc tatgcgcaat atgagaaaat taagccttac       360
     ctgttgaata atggacaaaa tccgccagct cgcgagcatt tacagatgcc agagcagcgc       420
     gaaaaactcg acgggctgta tgaatgtatt ctctgcgcat gttgttcaac ctcttgtccg       480
     tctttctggt ggaatcccga taagtttatc ggcccggcag gcttgttagc ggcatatcgt       540
     ttcctgattg atagccgtga taccgagact gacagccgcc tcgacggttt gagtgatgca       600
     ttcagcgtat tccgctgtca cagcatcatg aactgcgtca gtgtatgtcc gaaggggctg       660
     aacccgacgc gcgccatcgg ccatatcaag tcgatgttgt tgcaacgtaa tgcgtaa          717
//

If you have problems or comments...

PBIL Back to PBIL home page