(data stored in ACNUC7421 zone)

EMBL: CP000948.SEQA

CP000948.SEQA        Location/Qualifiers
FT   CDS_pept        764802..765347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="seqA"
FT                   /locus_tag="ECDH10B_0752"
FT                   /product="regulatory protein for replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01898"
FT                   /protein_id="ACB01898.1"
FT                   /translation="MKTIEVDDELYSYIASHTKHIGESASDILRRMLKFSAASQPAAPV
FT                   TKEVRVASPAIVEAKPVKTIKDKVRAMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQ
FT                   AFAEATESLHGRTRVYFAADEQTLLKNGNQTKPKHVPGTPYWVITNTNTGRKCSMIEHI
FT                   MQSMQFPAELIEKVCGTI"
     atgaaaacga ttgaagttga tgatgaactc tacagctata ttgccagcca cactaagcat        60
     atcggcgaga gcgcatccga cattttacgg cgtatgttga aattttccgc cgcatcacag       120
     cctgctgctc cggtgacgaa agaggttcgc gttgcgtcac ctgctatcgt cgaagcgaag       180
     ccggtcaaaa cgattaaaga caaggttcgc gcaatgcgtg aacttctgct ttcggatgaa       240
     tacgcagagc aaaagcgagc ggtcaatcgc tttatgctgc tgttgtctac actatattct       300
     cttgacgccc aggcgtttgc cgaagcaacg gaatcgttgc acggtcgtac acgcgtttac       360
     tttgcggcag atgaacaaac gctgctgaaa aatggtaatc agaccaagcc gaaacatgtg       420
     ccaggcacgc cgtattgggt gatcaccaac accaacaccg gccgtaaatg cagcatgatc       480
     gaacacatca tgcagtcgat gcaattcccg gcggaattga ttgagaaggt ttgcggaact       540
     atctaa                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page