(data stored in ACNUC7421 zone)

EMBL: CP000948.SFMD

CP000948.SFMD        Location/Qualifiers
FT   CDS_pept        498252..500855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmD"
FT                   /locus_tag="ECDH10B_0488"
FT                   /product="predicted outer membrane export usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01657"
FT                   /protein_id="ACB01657.1"
FT                   /translation="MKIPTTTDIPQRYTWCLAGICYSSLAILPSFLSYAESYFNPAFLL
FT                   ENGTSVADLSRFERGNHQPAGVYRVDLWRNDEFIGSQDIVFESTTENTGDKSGGLMPCF
FT                   NQVLLERIGLNSSAFPELAQQQNNKCINLLKAVPDATINFDFAAMRLNITIPQIALLSS
FT                   AHGYIPPEEWDEGIPALLLNYNFTGNRGNGNDSYFFSELSGINIGPWRLRNNGSWNYFR
FT                   GNGYHSEQWNNIGTWVQRAIIPLKSELVMGDGNTGSDIFDGVGFRGVRLYSSDNMYPDS
FT                   QQGFAPTVRGIARTAAQLTIRQNGFIIYQSYVSPGAFEITDLHPTSSNGDLDVTIDERD
FT                   GNQQNYTIPYSTVPILQREGRFKFDLTAGDFRSGNSQQSSPFFFQGTALGGLPQEFTAY
FT                   GGTQLSANYTAFLLGLGRNLGNWGAVSLDVTHARSQLADASRHEGDSIRFLYAKSMNTF
FT                   GTNFQLMGYRYSTQGFYTLDDVAYRRMEGYEYDYDGEHRDEPIIVNYHNLRFSRKDRLQ
FT                   LNVSQSLNDFGSLYISGTHQKYWNTSDSDTWYQVGYTSSWVGISYSLSFSWNESVGIPD
FT                   NERIVGLNVSVPFNVLTKRRYTRENALDRAYASFNANRNSNGQNSWLAGVGGTLLEGHN
FT                   LSYHVSQGDTSNNGYTGSATANWQAAYGTLGGGYNYDRDQHDVNWQLSGGVVGHENGIT
FT                   LSQPLGDTNVLIKAPGAGGVRIENQTGILTDWRGYAVMLYATVYRYNRIALDTNTMGNS
FT                   IDVEKNISSVVPTQGALVRANFDTRIGVRALITVTQGGKPVPFGSLVRENSTGITSMVG
FT                   DDGQVYLSGAPLSGELLVQWGDGANSRCIAHYVLPKQSLQQAVTVISAVCTHPGS"
     atgaaaatac ccactactac ggatattccg cagaggtata cctggtgtct ggccggaatt        60
     tgttattcat ctcttgccat tttaccctcc tttttaagct atgcggaaag ttatttcaac       120
     ccggcatttt tattagagaa tggcacatcc gttgctgatt tatcgcgctt tgagagaggt       180
     aatcatcaac ctgcgggcgt gtatcgggtg gatctctggc gtaatgatga gttcattggt       240
     tcgcaggata tcgtatttga atcgacaaca gaaaatacag gtgataaatc aggtgggtta       300
     atgccctgtt ttaaccaggt acttcttgaa cgaattggcc ttaatagcag tgcatttccc       360
     gagttagccc agcagcaaaa caataaatgc atcaatttac tgaaagctgt acctgatgcc       420
     acaattaact ttgattttgc agcgatgcgc ctgaacatca ctattcctca gatagcgttg       480
     ttgagtagcg ctcacggtta cattccgcct gaagagtggg atgaaggtat tcctgcttta       540
     ctcctgaatt ataatttcac cggtaacaga ggtaatggta acgatagcta tttttttagt       600
     gagctcagcg ggattaatat tggcccgtgg cgtttacgca acaatggttc ctggaactat       660
     tttcgcggaa atggatatca ttcagaacag tggaataata ttggcacctg ggtacagcgc       720
     gccattattc cgctgaaaag tgaactggta atgggagacg gcaatacagg aagtgatatt       780
     ttcgatggcg ttggatttcg tggtgtacgg ctttattctt ctgataatat gtatcctgat       840
     agccagcaag ggtttgcccc aacggtacgt gggattgccc gtacggcggc ccagctaacg       900
     attcggcaaa atggttttat tatctatcaa agctatgttt cccccggcgc ttttgaaatt       960
     acagatttgc acccgacatc ttcaaatggc gatctggacg tcaccatcga cgagcgcgat      1020
     ggcaatcagc agaattacac aattccgtat tcaacagtgc caattttaca acgcgaaggg      1080
     cgtttcaaat ttgacctgac ggcgggcgat tttcgtagcg gtaatagtca gcaatcatcg      1140
     cctttctttt ttcagggtac ggcactcggc ggtttaccac aggaatttac tgcctacggc      1200
     gggacgcaat tatctgccaa ttacaccgcc tttttattag ggctggggcg caatctcggg      1260
     aactggggcg cagtgtcgct ggatgtaacg catgcgcgca gtcagttagc cgacgccagt      1320
     cgtcatgagg gggattctat tcgcttcctc tatgcgaaat cgatgaacac cttcggcacc      1380
     aattttcagt taatgggtta ccgctattcg acacaaggtt tttataccct tgatgatgtt      1440
     gcgtatcgtc gaatggaggg gtacgaatat gattacgacg gtgagcatcg cgatgaaccg      1500
     ataatcgtga attaccacaa tttacgcttt agccgtaaag accgtttgca gttaaatgtt      1560
     tcacaatcac ttaatgactt tggctcgctt tatatttctg gtacccatca aaaatactgg      1620
     aatacttcgg attcagatac gtggtatcag gtggggtata ccagcagctg ggttggcatc      1680
     agttattcgc tctcattttc gtggaatgaa tctgtaggga tccccgataa cgaacgtatt      1740
     gtcggactta atgtttcagt gcctttcaat gttttgacca aacgtcgcta cacccgggaa      1800
     aatgcgctcg accgcgctta tgcctccttt aacgccaacc gtaacagcaa cgggcaaaat      1860
     agctggctgg caggtgtagg tgggacctta ctggaaggcc acaacctgag ttatcacgta      1920
     agccagggtg atacctcgaa taatgggtac acgggcagcg ccacggcaaa ctggcaggcc      1980
     gcttacggta cgctgggggg cgggtataac tacgaccgcg atcaacatga cgttaactgg      2040
     cagctgtctg gcggtgtggt cgggcatgaa aatggcataa cgctgagcca gcctttaggg      2100
     gataccaatg ttttgattaa agcgcctggc gcaggcggtg tacgcattga aaatcaaact      2160
     ggcattttaa ccgactggcg cggctatgcg gtgatgctgt atgccacggt ttatcggtat      2220
     aaccgtatcg cgcttgatac caatacgatg gggaattcca tcgatgttga aaaaaatatt      2280
     agcagcgttg tgccgacgca aggcgcgttg gttcgtgcca attttgatac ccgcataggc      2340
     gtgcgggcgc tcattaccgt tacccagggc ggaaaaccgg tgccgtttgg atcactggta      2400
     cgggaaaaca gtaccggaat aaccagtatg gtgggtgatg acgggcaagt ttatttaagt      2460
     ggtgcgccat tgtctggtga attactggtt cagtggggag acggcgcgaa ctcacgctgc      2520
     attgcgcact atgtattgcc gaagcaaagc ttacagcaag ccgtcactgt tatttcggca      2580
     gtttgcacac atcctggctc ataa                                             2604
//

If you have problems or comments...

PBIL Back to PBIL home page