(data stored in ACNUC7421 zone)

EMBL: CP000948.SFMH

CP000948.SFMH        Location/Qualifiers
FT   CDS_pept        500891..501874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmH"
FT                   /locus_tag="ECDH10B_0489"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01658"
FT                   /protein_id="ACB01658.1"
FT                   /translation="MAMACLCLANISWATVCANSTGVAEDEHYDLSNIFNSTNNQPGQI
FT                   VVLPEKSGWVGVSAICPPGTLVNYTYRSYVTNFIVQETIDNYKYMQLHDYLLGAMSLVD
FT                   SVMDIQFPPQNYIRMGTDPNVSQNLPFGVMDSRLIFRLKVIRPFINMVEIPRQVMFTVY
FT                   VTSTPYDPLVTPVYTISFGGRVEVPQNCELNAGQIVEFDFGDIGASLFSAAGPGNRPAG
FT                   VMPQTKSIAVKCTNVAAQAYLTMRLEASAVSGQAMVSDNQDLGFIVADQNDTPITPNDL
FT                   NSVIPFRLDAAAAANVTLRAWPISITGQKPTEGPFSALGYLRVDYQ"
     ttggcgatgg catgtttgtg tctggcaaac atatcctggg ctactgtttg tgcaaatagt        60
     actggcgtag cagaagatga acactatgat ctctcaaata tctttaatag caccaataac       120
     cagccagggc agattgttgt tttaccggaa aaatccggct gggtaggtgt ctcagcaatt       180
     tgtccacccg gtacgctggt gaattataca taccgtagtt atgtcaccaa ctttattgtt       240
     caggaaacta tcgataatta taaatatatg caattacatg attatctatt aggtgcgatg       300
     agtctggttg atagtgtgat ggatattcag ttccccccgc aaaattatat tcggatggga       360
     acagatccta acgtttcgca aaaccttcca ttcggggtga tggattctcg tttaatattt       420
     cgtttaaagg ttattcgtcc ctttattaac atggtggaga tccccagaca ggtgatgttt       480
     accgtgtatg tgacatcaac gccttacgat ccgttggtta cacctgttta taccattagt       540
     tttggtggcc gggttgaagt accgcaaaac tgcgaattaa atgccgggca gattgttgaa       600
     tttgattttg gtgatatcgg cgcatcgtta tttagtgcgg cagggccggg taatcgacct       660
     gctggtgtca tgccgcaaac caagagcatt gcggtcaaat gtacgaatgt tgctgcgcag       720
     gcttatttaa caatgcgtct ggaagccagt gccgtttctg gtcaggcgat ggtgtcggac       780
     aatcaggatt taggttttat tgtcgccgat cagaacgata cgccgatcac gcctaacgat       840
     ctcaatagcg ttattccttt ccgtctggat gcagctgcgg cagccaatgt cacacttcgc       900
     gcctggccta tcagtattac cggtcaaaaa ccgaccgaag ggccgtttag cgcgctgggg       960
     tatttacgcg tcgattatca atga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page