(data stored in ACNUC7421 zone)

EMBL: CP000948.TAUB

CP000948.TAUB        Location/Qualifiers
FT   CDS_pept        324762..325529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="ECDH10B_0322"
FT                   /product="taurine transporter subunit; ATP-binding
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01497"
FT                   /protein_id="ACB01497.1"
FT                   /translation="MLQISHLYADYGGKPALEDINLTLESGELLVVLGPSGCGKTTLLN
FT                   LIAGFVPYQHGSIQLAGKRIEGPGAERGVVFQNEGLLPWRNVQDNVAFGLQLAGIEKMQ
FT                   RLEIAHQMLKKVGLEGAEKRYIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAFT
FT                   RDQMQTLLLKLWQETGKQVLLITHDIEEAVFMATELVLLSSGPGRVLERLPLNFARRFV
FT                   AGESSRSIKSDPQFIAMREYVLSRVFEQREAFS"
     atgctgcaaa tctctcatct ttacgccgat tatggcggca aaccggcact ggaagatatc        60
     aacctgacgc tggaaagcgg cgagctactg gtggtgctgg ggccgtccgg ctgcggtaaa       120
     accaccctgc tgaatctgat tgccggtttt gtgccttatc agcatggcag cattcaactg       180
     gcgggtaagc gtattgaggg accgggagca gagcgtggcg tagtttttca gaatgaaggg       240
     ctactaccgt ggcgcaatgt acaggacaac gtggcgttcg gcctgcaatt ggcaggtata       300
     gagaaaatgc agcgactgga aatcgcgcac cagatgctga aaaaagtggg gctggaaggc       360
     gcagaaaaac gctacatctg gcagctttcc ggtggtcaac gtcagcgggt ggggattgct       420
     cgtgcgctgg cggcgaatcc ccagctgtta ttactcgacg aaccgtttgg tgcgctggac       480
     gccttcaccc gcgaccagat gcaaaccctg ctgctgaaac tctggcagga gacgggcaag       540
     caggtgctgt tgattaccca cgatatagaa gaagcggtgt ttatggcgac tgaactggtt       600
     ctgctttcat ccggccctgg ccgtgtgctg gagcggctgc cgctcaactt tgctcgccgc       660
     tttgttgcgg gagagtcgag ccgcagcatc aagtccgatc cacaattcat cgccatgcgc       720
     gaatatgttt taagccgcgt atttgagcaa cgggaggcgt tctcatga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page