(data stored in ACNUC7421 zone)

EMBL: CP000948.TAUC

CP000948.TAUC        Location/Qualifiers
FT   CDS_pept        325526..326353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="ECDH10B_0323"
FT                   /product="taurine transporter subunit; membrane component
FT                   of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01498"
FT                   /protein_id="ACB01498.1"
FT                   /translation="MSVLINEKLHSRRLKWRWPLSRQVTLSIGTLAVLLTVWWTVATLQ
FT                   LISPLFLPPPQQVLEKLLTIAGPQGFMDATLWQHLAASLTRIMLALFAAVLFGIPVGIA
FT                   MGLSPTVRGILDPIIELYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSALA
FT                   GVKSVQQVRIRAAQSLGASRAQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELIAA
FT                   TRGLGFMVQSAGEFLATDVVLAGIAVIAIIAFLLELGLRALQRRLTPWHGEVQ"
     atgagtgtgc tcattaatga aaaactgcat tcgcggcggc tgaaatggcg ctggccgctc        60
     tcgcgtcagg tgaccttaag cattggcacg ttagcggttt tactcaccgt atggtggacg       120
     gtggcgacgc tgcaactgat tagcccgcta tttttgccgc cgccgcaaca ggtactggaa       180
     aaactactca ccattgccgg accgcaaggc tttatggacg ccacgctgtg gcagcatctg       240
     gcagccagtc tgacgcgcat tatgctggcg ctatttgcag cggtgttgtt cggtattccg       300
     gtcgggatcg cgatgggact tagccctacg gtacgcggca ttctggatcc gataatcgag       360
     ctttatcgtc cggtgccgcc gctggcttat ttgccgctga tggtgatctg gtttggtatt       420
     ggtgaaacct cgaagatctt actgatctat ttagcgattt ttgcaccggt ggcgatgtcg       480
     gcgctggcgg gggtgaaaag cgtgcagcag gttcgcattc gtgccgccca gtcgctgggt       540
     gccagccgtg cgcaggtgct gtggtttgtc attttgcccg gtgcgctgcc ggaaatcctc       600
     accggattac gtattggtct gggggtgggc tggtctacgc tggtggcggc ggagctgatt       660
     gccgcgacgc gcggtttagg atttatggtt cagtcagcgg gtgaatttct cgcaactgac       720
     gtggtgctgg cggggatcgc ggtgattgcg attatcgcct ttcttttaga actgggtctg       780
     cgcgcgttac agcgccgcct gacgccctgg catggagaag tacaatga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page