(data stored in ACNUC7421 zone)

EMBL: CP000948.THRB

CP000948.THRB        Location/Qualifiers
FT   CDS_pept        2801..3733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="ECDH10B_0003"
FT                   /product="homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01208"
FT                   /db_xref="GOA:B1XBC8"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XBC8"
FT                   /protein_id="ACB01208.1"
FT                   /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGALLGDVVTVEAAETFS
FT                   LNNLGRFADKLPSEPRENIVYQCWERFCQELGKQIPVAMTLEKNMPIGSGLGSSACSVV
FT                   AALMAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENDIISQ
FT                   QVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPELA
FT                   AKLMKDVIAEPYRERLLPGFRQARQAVAEIGAVASGISGSGPTLFALCDKPETAQRVAD
FT                   WLGKNYLQNQEGFVHICRLDTAGARVLEN"
     atggttaaag tttatgcccc ggcttccagt gccaatatga gcgtcgggtt tgatgtgctc        60
     ggggcggcgg tgacacctgt tgatggtgca ttgctcggag atgtagtcac ggttgaggcg       120
     gcagagacat tcagtctcaa caacctcgga cgctttgccg ataagctgcc gtcagaacca       180
     cgggaaaata tcgtttatca gtgctgggag cgtttttgcc aggaactggg taagcaaatt       240
     ccagtggcga tgaccctgga aaagaatatg ccgatcggtt cgggcttagg ctccagtgcc       300
     tgttcggtgg tcgcggcgct gatggcgatg aatgaacact gcggcaagcc gcttaatgac       360
     actcgtttgc tggctttgat gggcgagctg gaaggccgta tctccggcag cattcattac       420
     gacaacgtgg caccgtgttt tctcggtggt atgcagttga tgatcgaaga aaacgacatc       480
     atcagccagc aagtgccagg gtttgatgag tggctgtggg tgctggcgta tccggggatt       540
     aaagtctcga cggcagaagc cagggctatt ttaccggcgc agtatcgccg ccaggattgc       600
     attgcgcacg ggcgacatct ggcaggcttc attcacgcct gctattcccg tcagcctgag       660
     cttgccgcga agctgatgaa agatgttatc gctgaaccct accgtgaacg gttactgcca       720
     ggcttccggc aggcgcggca ggcggtcgcg gaaatcggcg cggtagcgag cggtatctcc       780
     ggctccggcc cgaccttgtt cgctctgtgt gacaagccgg aaaccgccca gcgcgttgcc       840
     gactggttgg gtaagaacta cctgcaaaat caggaaggtt ttgttcatat ttgccggctg       900
     gatacggcgg gcgcacgagt actggaaaac taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page