(data stored in ACNUC7421 zone)

EMBL: CP000948.YAAW

CP000948.YAAW        Location/Qualifiers
FT   CDS_pept        complement(10643..11356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaW"
FT                   /locus_tag="ECDH10B_0011"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01216"
FT                   /protein_id="ACB01216.1"
FT                   /translation="MNVNYLNDSDLDFLQHCSEEQLANFARLLTHNEKGKTRLSSVLMR
FT                   NELFKSMEGHPEQHRRNWQLIAGELQHFGGDSIANKLRGHGKLYRAILLDVSKRLKLKA
FT                   DKEMSTFEIEQQLLEQFLRNTWKKMDEEHKQEFLHAVDARVNELEELLPLLMKDKLLAK
FT                   GVSHLLSSQLTRILRTHAAMSVLGHGLLRGAGLGGPVGAALNGVKAVSGSAYRVTIPAV
FT                   LQIACLRRMVSATQV"
     atgaatgtta attacctgaa tgattcagat ctggattttc ttcagcattg tagtgaggaa        60
     cagttggcaa atttcgcccg attgctcacc cataatgaaa aaggcaaaac tcgcctctcc       120
     agcgtactga tgcgcaacga actgtttaaa tcgatggaag ggcatcccga gcaacatcgc       180
     cgcaactggc agctgattgc cggagaatta cagcattttg gtggcgatag tatcgccaac       240
     aaactgcgcg gacacggtaa attgtatcgg gccattttgc tcgatgtttc aaagcgattg       300
     aagctgaaag ccgacaaaga gatgtctacg tttgaaattg agcaacagtt actggaacaa       360
     tttctgcgta atacctggaa gaaaatggac gaggaacata agcaggagtt tctgcacgcg       420
     gtcgatgcca gggtgaatga gctggaagag ctgctgccgc tgctgatgaa agacaaatta       480
     ttggcaaaag gtgtgtcgca tttgctttcc agccaactga cccgcatttt acgcacccac       540
     gcagcaatga gcgtacttgg gcatggtttg ctgcgcggcg cggggctggg aggccctgta       600
     ggtgcggcac taaatggggt taaagcggtc agcggcagcg cctatcgcgt gacgattcca       660
     gccgtactgc aaatcgcctg cctgcgccgg atggttagcg ccactcaggt ctga             714
//

If you have problems or comments...

PBIL Back to PBIL home page