(data stored in ACNUC7421 zone)

EMBL: CP000948.YACC

CP000948.YACC        Location/Qualifiers
FT   CDS_pept        complement(110674..111021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacC"
FT                   /locus_tag="ECDH10B_0102"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01301"
FT                   /protein_id="ACB01301.1"
FT                   /translation="MKTFFRTVLFGSLMAVCANSYALSESEAEDMADLTAVFVFLKNDC
FT                   GYQNLPNGQIRRALVFFAQQNQWDLSNYDTFDMKALGEDSYRDLSGIGIPVAKKCKALA
FT                   RDSLSLLAYVK"
     atgaagacgt ttttcagaac agtgttattc ggcagcctga tggccgtctg cgcaaacagt        60
     tacgcgctca gcgagtctga agccgaagat atggccgatt taacggcagt ttttgtcttt       120
     ctgaagaacg attgtggtta ccagaactta cctaacgggc aaattcgtcg cgcactggtc       180
     tttttcgctc agcaaaacca gtgggacctc agtaattacg acaccttcga catgaaagcc       240
     ctcggtgaag acagctaccg cgatctcagc ggcattggca ttcccgtcgc taaaaaatgc       300
     aaagccctgg cccgcgattc cttaagcctg cttgcctacg tcaaataa                    348
//

If you have problems or comments...

PBIL Back to PBIL home page