(data stored in ACNUC7421 zone)

EMBL: CP000948.YADC

CP000948.YADC        Location/Qualifiers
FT   CDS_pept        complement(123819..125057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadC"
FT                   /locus_tag="ECDH10B_0115"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01314"
FT                   /protein_id="ACB01314.1"
FT                   /translation="MKTIFRYILFLALYSCCNTVSAYTSFIVGNNAGVDNYRGPSTAAQ
FT                   MTFNYTSTASNLVFYKPTQLGPTGVKMYWSYLDTGTGGGILYCNTSGRANPGPITIENA
FT                   MVYSGKDYGGHKLFNTSVPGLYYTMLISRVWSAYDTITDIQSPGIYIGDPSNQEFFFSV
FT                   TDSDLQTKGCNKADDYDKFWAIGGIVHNITVEFYTDTNFDPTLNQQVQLSSSSNYLYSF
FT                   KAYSPGTKVVDHSNHIYVNFTLNNVKLTLPTCFTSILTGPSVNGSTVRMGEYSSGTIKN
FT                   GASPVPFDISLQNCIRVRNIETKLVTGKVGTQNTQLLGNTLTGSTAAKGVGVLIEGLAT
FT                   SKNPLMTLKPNDTNSVYIDYETEDDTSDGVYPNQGNGTSQPLHFQATLKQDGNIAIEPG
FT                   EFKATSTFQVTYP"
     atgaagacta tcttcaggta cattcttttt ttagcactgt attcttgttg taatacagtc        60
     agtgcatata caagttttat tgtgggaaat aatgcaggag ttgataacta tcgaggcccc       120
     tccactgccg cacagatgac ctttaattac acatcaacag caagcaactt ggttttttat       180
     aaacccacgc agctcggccc gactggggta aaaatgtact ggtcatacct ggatacaggt       240
     accggtggtg gtattcttta ctgcaataca tctggcagag cgaatcctgg tccaataact       300
     attgaaaatg ccatggtcta ttcaggtaaa gattatggcg gacataaact atttaataca       360
     tctgttcctg gtctgtatta caccatgtta atatcaaggg tctggtctgc atacgataca       420
     ataactgaca ttcaatcgcc aggaatctat atcggagatc cttccaacca agaatttttc       480
     ttttccgtca cagacagcga tctacaaact aagggttgca acaaagcaga cgactacgat       540
     aagttttggg ctattggtgg tatagtacac aacataactg ttgaatttta tacagatact       600
     aatttcgatc ctacacttaa tcagcaagtc cagttatcca gttcatcaaa ttacctttat       660
     tcgtttaagg cctacagtcc tggtacaaaa gttgtagatc acagcaacca catttatgtc       720
     aatttcacac tgaataatgt caaattaacc ttaccaacat gttttacctc catacttacc       780
     gggccatcag tcaatggttc aacggttaga atgggagaat atagctctgg gacaattaaa       840
     aatggcgctt cacctgttcc ctttgatatc tcgcttcaga attgtattcg tgtgcgtaat       900
     attgaaacaa aactcgtcac tggaaaagta ggtactcaaa acacacaact gcttggtaat       960
     acgcttactg gaagcactgc cgccaaaggc gttggcgtac tcattgaagg tttagcaacc      1020
     agtaaaaatc cgctaatgac attaaaacct aatgatacga attctgttta tatagattat      1080
     gaaaccgaag atgacacctc cgatggggtt taccctaatc aaggtaacgg cacatcacag      1140
     cctcttcatt tccaggcaac attaaagcaa gacgggaata ttgctatcga acccggcgaa      1200
     tttaaagcca ccagtacttt ccaggtaacc tatccctga                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page