(data stored in ACNUC7421 zone)

EMBL: CP000948.YADG

CP000948.YADG        Location/Qualifiers
FT   CDS_pept        116883..117809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadG"
FT                   /locus_tag="ECDH10B_0107"
FT                   /product="predicted transporter subunit: ATP-binding
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01306"
FT                   /protein_id="ACB01306.1"
FT                   /translation="MTIALELQQLKKTYPGGVQALRGIDLQVEAGDFYALLGPNGAGKS
FT                   TTIGIISSLVNKTSGRVSVFGYDLEKDVVNAKRQLGLVPQEFNFNPFETVQQIVVNQAG
FT                   YYGVERKEAYIRSEKYLKQLDLWGKRNERARMLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRRSMWGFLKDLNDKGTTIILTTHYLEEAEMLCRNIGIIQHGELVENTSMKA
FT                   LLAKLKSETFILDLAPKSPLPKLDGYQYRLVDTATLEVEVLREQGINSVFTQLSEQGIQ
FT                   VLSMRNKANRLEELFVSLVNEKQGDRA"
     atgaccattg cactggaact tcaacagctt aaaaaaacct atccaggcgg cgttcaggcg        60
     cttcgtggga tagatttgca ggtcgaagcg ggtgattttt atgcgcttct cgggccgaac       120
     ggggccggga aatcgaccac tatcggtatt atcagctctc tggtaaataa aacctccggg       180
     cgggtcagcg tatttggtta cgatctcgag aaggatgtcg tgaacgctaa acgtcagttg       240
     ggactggtgc cgcaggaatt taacttcaac ccgtttgaaa ccgtgcagca aattgtggtg       300
     aatcaggcag ggtactacgg cgtggagcgc aaagaagcgt acatccgcag cgaaaagtat       360
     cttaaacaac tcgatctatg gggaaaacgc aacgaacgtg cgcgtatgtt atctggcggg       420
     atgaagcgcc gtttaatgat tgcccgtgcg ttaatgcatg aacctaaact actgattctc       480
     gacgaaccga ccgcaggcgt ggatattgaa cttcgccgct caatgtgggg ctttttgaag       540
     gatttaaacg acaaaggcac caccatcatt ctcaccacac actacctgga agaagcagaa       600
     atgctgtgcc gcaatatcgg cattattcaa cacggtgagc tggtggaaaa tacctcgatg       660
     aaggcgctgc tggcgaagct gaaatcggaa acctttattc tcgatctcgc accgaaaagc       720
     ccgttaccga agctcgatgg ctatcagtat cgactggtcg ataccgcgac gctggaagtt       780
     gaagtgctgc gtgagcaggg gatcaacagc gtatttacgc agttaagtga gcagggcatt       840
     caggtattaa gtatgcgtaa caaagctaac cgtctggaag agctgtttgt ttcactggtt       900
     aatgaaaaac aaggagatcg cgcatga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page