(data stored in ACNUC7421 zone)

EMBL: CP000948.YADH

CP000948.YADH        Location/Qualifiers
FT   CDS_pept        117806..118576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadH"
FT                   /locus_tag="ECDH10B_0108"
FT                   /product="predicted transporter subunit: membrane component
FT                   of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01307"
FT                   /protein_id="ACB01307.1"
FT                   /translation="MMHLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNL
FT                   IGSRIGDMHGFSYMQFIVPGLIMMSVITNAYANVASSFFGAKFQRNIEELLVAPVPTHV
FT                   IIAGYVGGGVARGLFVGILVTAISLFFVPFQVHSWVFVALTLVLTAVLFSLAGLLNGVF
FT                   AKTFDDISLVPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGIN
FT                   DVPLVTTFGVLVVFIVAFYLICWSLIQRGRGLRS"
     atgatgcatc tttactgggt ggcgctaaaa agcatctggg cgaaagagat ccatcgcttt        60
     atgcgtatct gggtgcagac gctggtgccg ccagtcatca ccatgaccct ttactttatt       120
     atcttcggta acctgattgg ttcgcgtatt ggcgatatgc atggcttcag ctatatgcag       180
     ttcatcgtac cggggctgat catgatgtcg gtgatcacca atgcctacgc caacgttgcg       240
     tcatcatttt ttggtgccaa gttccagcgt aatattgaag agctgctggt agcgccggtt       300
     ccgactcacg tcattattgc cggatatgtc ggcggtggcg tggcgcgtgg tctgtttgtt       360
     ggcattctgg tgacggcaat ttcactgttt tttgtgccat ttcaggtgca ttcgtgggta       420
     ttcgttgcct taacgctggt gctcacggcg gtgttgttct cccttgcggg tttgctgaac       480
     ggtgtgtttg ccaaaacgtt cgatgacatc agcctggtgc caacctttgt gttaacgcca       540
     ctcacgtatt tgggcggggt cttttactca ctgactttgt tgccgccgtt ctggcaaggg       600
     ctgtcgcacc tgaacccaat cgtttatatg atcagtggtt tccgctacgg cttcctcggt       660
     atcaatgatg ttccgctggt cactaccttt ggcgtactgg tggtctttat tgtggcgttt       720
     tatttgatct gttggtcgct gatccaacgt ggacgtggtt tgcgtagcta a                771
//

If you have problems or comments...

PBIL Back to PBIL home page