(data stored in ACNUC7421 zone)

EMBL: CP000948.YADK

CP000948.YADK        Location/Qualifiers
FT   CDS_pept        complement(125107..125703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadK"
FT                   /locus_tag="ECDH10B_0116"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01315"
FT                   /protein_id="ACB01315.1"
FT                   /translation="MHPTQRKLMKRIILFLSLLFCIACPAIAGQDIDLVANVKNSTCKS
FT                   GISNQGNIDLGVVGVGYFSGNVTPESYQPGGKEFTITVSDCALQGTGDVLNQLHIDFRA
FT                   LSGVMAAGSRQIFANEISSGASNVGVVIFSTQDSANTFNVLNASGGSRSVYPVMSDDMN
FT                   GSSWKFSTRMQKIDPALSVTSGQLMSHVLVDIYYE"
     atgcatccca ctcaacgtaa gctgatgaag agaataattc tgtttctgtc attactgttt        60
     tgcatcgcct gtccagccat tgctggacag gatattgacc ttgttgccaa tgtaaaaaac       120
     agcacctgca aaagcggaat cagtaaccag ggtaatattg atcttggcgt cgttggggtg       180
     ggatattttt caggtaatgt tactcctgaa agttatcaac caggtggaaa agagttcact       240
     atcactgtat ccgactgtgc attacaggga actggcgatg tgctaaatca gttacatatt       300
     gattttagag cccttagcgg tgtcatggct gctggctcta ggcaaatatt tgctaatgaa       360
     atttcgtcag gagcaagtaa tgtaggagta gttatatttt ctactcagga ttcggcgaat       420
     acattcaatg ttcttaatgc ttcaggcgga tctcgttccg tttatccagt aatgtcggat       480
     gacatgaatg gttcatcctg gaaatttagc acccgaatgc aaaaaatcga tcctgcattg       540
     agtgttacat ctggtcaact tatgagccat gtgttagtgg atatttacta cgaataa          597
//

If you have problems or comments...

PBIL Back to PBIL home page