(data stored in ACNUC7421 zone)

EMBL: CP000948.YADL

CP000948.YADL        Location/Qualifiers
FT   CDS_pept        complement(125730..126335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadL"
FT                   /locus_tag="ECDH10B_0117"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01316"
FT                   /protein_id="ACB01316.1"
FT                   /translation="MMTFKNLRYGLSSSVVLAASLFSVLSYAATDSIGLTVITTVEMGT
FT                   CTATLVNDSDQDISVVDFGDVYISEINAKTKVKTFKLKFKDCAGIPNKKAQIKLTKRAT
FT                   CEGTANDGAGFANGSTAADKASAVAVEVWSTVTPATGSATQFSCVTPASQEVTISTAAN
FT                   AVVYYPMSARLVVEKNKTVNNVTAGKFSAPATFTVTYN"
     atgatgacat ttaaaaattt acgttatgga ttatccagca gtgtcgtttt ggctgcctca        60
     ttgttcagcg tactctctta tgcggcaaca gacagtattg gactgaccgt tattactact       120
     gtagaaatgg gtacttgtac cgctacatta gtaaatgact ctgatcagga catttctgtt       180
     gttgattttg gtgatgtata tatttctgaa atcaatgcca agaccaaagt aaaaacattc       240
     aaactcaaat tcaaagactg tgcgggtatc cccaataaaa aagcgcaaat aaaattaacc       300
     aagcgagcca catgcgaggg aactgctaat gacggtgcgg ggtttgcaaa tggttccaca       360
     gccgcagata aagcaagtgc tgtcgccgtt gaagtctgga gcactgtaac tccggcaaca       420
     gggagtgcaa cacaatttag ctgtgtaaca ccagcatcac aagaggtaac aatctccact       480
     gcagccaatg cggtcgttta ttatccgatg agtgcacgcc tggtcgtgga aaaaaataaa       540
     accgtaaaca atgtcactgc gggtaagttt tctgcaccag ccacatttac agtaacctat       600
     aactaa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page