(data stored in ACNUC7421 zone)

EMBL: CP000948.YADM

CP000948.YADM        Location/Qualifiers
FT   CDS_pept        complement(126347..126916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadM"
FT                   /locus_tag="ECDH10B_0118"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01317"
FT                   /protein_id="ACB01317.1"
FT                   /translation="MIKTTPHKIVILMGILLSPSVFATDINVEFTATVKATTCNITLTG
FT                   NNVTNDGNNNYTLRIPKMGLDKIANKTTESQADFKLVASGCSSGISWIDTTLTGNASSS
FT                   SPKLIIPQSGDSSSTTSNIGMGFKKRTTDDATFLKPNSAEKIRWSTDEMQPDKGLEMTV
FT                   ALRETDAGQGVPGNFRALATFNFIYQ"
     atgataaaaa caacgccaca taaaatagtg atactgatgg gaatattatt atcaccctca        60
     gtatttgcaa cggatattaa tgtagagttt acagccactg tcaaagcgac aacctgtaac       120
     atcacactta ctggtaataa cgtcacgaat gatggcaata ataactacac attgagaatc       180
     cctaagatgg gtctggataa gatcgcgaat aaaacgacag aatctcaggc tgattttaaa       240
     ctggttgcca gtgggtgcag cagtggcatc agttggattg ataccactct gaccggaaat       300
     gcatcatcaa gctcacctaa gcttattata ccgcagtctg gtgattcatc ttcgacgaca       360
     agtaatatcg gtatgggttt caaaaaacgg actactgatg atgccacttt ccttaaacct       420
     aacagtgcgg aaaagatacg ctggagcaca gacgagatgc agcccgataa gggtcttgaa       480
     atgaccgttg cgctacgtga aacagatgca gggcaaggcg taccggggaa ttttcgtgca       540
     ctggcgacgt ttaatttcat ctatcaataa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page