(data stored in ACNUC7421 zone)

EMBL: CP000948.YADN

CP000948.YADN        Location/Qualifiers
FT   CDS_pept        complement(130403..130987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadN"
FT                   /locus_tag="ECDH10B_0121"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01320"
FT                   /protein_id="ACB01320.1"
FT                   /translation="MSKKLGFALSGLMLAMVAGTASADMDGGQLNISGLVVDNTCETRV
FT                   DGGNKDGLILLQTATVGEIDAGVLNDTVGAKAKPFSITVDCSKANPNPGSTAKMTFGSV
FT                   FFGNSKGTLNNDMSINNPSDGVNIALHNIDGSTIKQVQINNPGDVYTKALDATTKSAVY
FT                   DFKASYVRAVADQTATAGYVKTNTAYTITYQ"
     atgtctaaaa aattaggttt tgccctgtct ggtcttatgc tggcgatggt tgcaggtact        60
     gcttctgctg atatggacgg cggtcagtta aatatcagtg gtctggttgt tgataacacc       120
     tgtgaaaccc gcgttgacgg cggtaacaag gatggtctga tcctgctgca aaccgcaacc       180
     gttggtgaaa tcgatgctgg cgtactgaat gacaccgttg gcgctaaagc taaacctttc       240
     agcatcaccg ttgactgcag caaagcaaat ccgaatccag gtagcacggc taaaatgacc       300
     ttcggttctg ttttctttgg taacagcaaa gggactttga acaacgacat gtctattaac       360
     aacccatctg acggcgttaa tatcgctcta cacaatattg atggttccac tatcaaacag       420
     gttcaaatta acaaccctgg cgatgtgtat actaaagccc tggatgcaac gacaaaatct       480
     gctgtttatg attttaaagc gtcttacgtt cgtgccgtcg cagaccaaac agcaactgct       540
     ggttatgtaa aaactaacac tgcatacacc attacttatc agtaa                       585
//

If you have problems or comments...

PBIL Back to PBIL home page