(data stored in ACNUC7421 zone)

EMBL: CP000948.YADR

CP000948.YADR        Location/Qualifiers
FT   CDS_pept        150714..151058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadR"
FT                   /locus_tag="ECDH10B_0136"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01335"
FT                   /db_xref="GOA:B1XD26"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XD26"
FT                   /protein_id="ACB01335.1"
FT                   /translation="MSDDVALPLEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGF
FT                   QYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKS
FT                   TCGCGSSFSI"
     atgagtgatg acgtagcact gccgctggag tttaccgacg cagcagccaa caaagttaaa        60
     agcctgatcg ctgacgaaga taacccgaat ctgaaattac gcgtgtatat caccggtggc       120
     ggttgcagcg gcttccagta tggtttcacc tttgatgatc aggtgaacga aggcgatatg       180
     accatcgaaa aacagggcgt tggcctggtg gttgatccga tgagcctgca atatctggtc       240
     ggcggttccg ttgattatac cgaaggtctg gaaggttctc gtttcatcgt gaccaacccg       300
     aacgcgaaaa gcacctgcgg ttgcggttct tcctttagta tctaa                       345
//

If you have problems or comments...

PBIL Back to PBIL home page