(data stored in ACNUC7421 zone)

EMBL: CP000948.YAEJ

CP000948.YAEJ        Location/Qualifiers
FT   CDS_pept        188937..189359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeJ"
FT                   /locus_tag="ECDH10B_0172"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01370"
FT                   /protein_id="ACB01370.1"
FT                   /translation="MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRA
FT                   SSLPEYYKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAMIKELTTEKKA
FT                   RRPTRPTRASKERRLASKAQKSSVKAMRGKVRSGRE"
     atgattgtga tttcccgaca tgttgctatt cccgatggtg agcttgagat caccgccatt        60
     cgtgcgcagg gcgcgggcgg gcagcatgtt aataagacct caacggctat tcatctgcgt       120
     tttgacattc gggcgtccag cctgccagag tattacaaag agcgtctgct cgccgccagc       180
     catcatttga tcagcagtga tggcgtgatt gtcattaagg cacaggaata ccgcagtcag       240
     gaactgaacc gcgaagcagc tctggcccgg ctggtggcta tgattaaaga attaacaaca       300
     gaaaaaaaag cccgacgacc cacgcggccc acccgtgcat cgaaagagcg caggctggca       360
     tcgaaagcac aaaaatcaag cgtgaaggcg atgcgcggca aagtgcgcag cggtcgggaa       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page