(data stored in ACNUC7421 zone)

EMBL: CP000948.YAEQ

CP000948.YAEQ        Location/Qualifiers
FT   CDS_pept        188395..188940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeQ"
FT                   /locus_tag="ECDH10B_0171"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01369"
FT                   /protein_id="ACB01369.1"
FT                   /translation="MALKATIYKATVNVADLDRNQFLDASLTLARHPSETQERMMLRLL
FT                   AWLKYADERLQFTRGLCADDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQAAEVAL
FT                   FTYNSRAAQIWWQQNQSKCVQFANLSVWYLDDEQLAKVSAFADRTMTLQATIQDGVIWL
FT                   SDDKNNLEVNLTAWQQPS"
     atggcgctta aagcgacaat ttataaagcg acggttaatg tggccgatct cgaccgcaac        60
     cagtttctcg atgcctctct gacgctggcg cgccatcctt cagaaaccca ggagcgtatg       120
     atgctgcgct tgctggcgtg gctgaaatat gctgatgaac gtctgcaatt tacccgtggt       180
     ttgtgtgccg atgatgagcc ggaagcgtgg ctgcgtaacg atcacctggg cattgatttg       240
     tggattgagc tggggctgcc ggatgagcgg cggattaaga aagcctgcac ccaggccgca       300
     gaagtggcgc tgtttaccta taatagtcgg gcggcgcaaa tctggtggca gcaaaatcag       360
     agcaaatgtg tgcagtttgc caatctttcc gtctggtatc tggacgatga acaactggcg       420
     aaagtaagcg cctttgccga tcgtaccatg acgctgcagg caacgattca ggatggcgtg       480
     atctggttat cggatgataa gaataatctg gaagtgaact taaccgcctg gcaacaacct       540
     tcatga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page