(data stored in ACNUC7421 zone)

EMBL: CP000948.YAFK

CP000948.YAFK        Location/Qualifiers
FT   CDS_pept        complement(219169..219909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafK"
FT                   /locus_tag="ECDH10B_0206"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01395"
FT                   /protein_id="ACB01395.1"
FT                   /translation="MRKIALILAMLLIPCVSFAGLLGSSSSTTPVSKEYKQQLMGSPVY
FT                   IQIFKEERTLDLYVKMGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLK
FT                   PDSRYYKAINIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV
FT                   FGQPSVQVSIYPFRMTDANMKRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVVNGRYV
FT                   VSKPLSHEVVQPQLASNYTLPEAK"
     atgcgtaaaa tcgcattaat tcttgcgatg ttgttgatcc cgtgcgtttc atttgccggt        60
     ttgctgggca gcagtagctc taccacgcct gtgagcaaag agtataagca gcagttgatg       120
     ggatcccctg tctacatcca gatcttcaag gaagaacgta cgctcgatct ctacgtcaaa       180
     atgggcgagc aatatcaact gctcgacagc tataaaatct gtaaatattc cggcggctta       240
     gggccaaaac agcgtcaggg cgatttcaaa agcccggaag ggttttatag cgtccagcgt       300
     aatcagttaa aaccagacag ccgttactac aaagcgatta atattggttt ccccaatgcc       360
     tatgaccgtg cgcatggtta tgaagggaaa tacctgatga tccacggcga ttgtgtttcc       420
     atcggctgct acgcaatgac caatcagggt attgatgaga tattccagtt cgttactggt       480
     gcgctggtgt ttggtcagcc gagcgtgcaa gtgagtattt acccgttccg catgaccgac       540
     gccaatatga agcgccataa atattccaac tttaaggact tctgggagca actgaagccg       600
     ggttacgact actttgagca aacccgtaag ccaccaaccg tttctgtggt caatggtcgt       660
     tacgtggtca gcaagccgtt aagccacgaa gttgtgcagc cacaactggc atcaaactac       720
     acgctccccg aggcaaaata a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page