(data stored in ACNUC7421 zone)

EMBL: CP000948.YAFM

CP000948.YAFM        Location/Qualifiers
FT   CDS_pept        221741..222238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafM"
FT                   /locus_tag="ECDH10B_0210"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01399"
FT                   /protein_id="ACB01399.1"
FT                   /translation="MSEYRRYYIKGGTWFFTVNLRNRRSQLLTTQYQMLRHAIIKVKRD
FT                   RPFEINAWVVLPEHMHCIWTLPEGDDDFSSRWREIKKQFTHACGLKNIWQPRFWEHAIR
FT                   NTKDYRHHVDYIYINPVKHGWVKQVSDWPFSTFHRDVARGLYPIDWAGDVTDFSAGERI
FT                   IS"
     atgtctgaat atcgtcgtta ttacatcaag gggggaacat ggtttttcac ggtgaattta        60
     cgaaatcgtc gaagccaact tttgaccacc cagtaccaga tgctccgtca cgccattatt       120
     aaagttaagc gagacaggcc ttttgaaatc aacgcctggg tcgttttgcc agagcatatg       180
     cactgtatct ggacattacc tgaaggcgat gatgattttt cctcgcgctg gcgggaaatt       240
     aaaaagcaat ttacccatgc ttgtggattg aaaaatatct ggcaaccacg tttttgggag       300
     cacgccatcc gcaataccaa agattatagg catcatgttg attatattta tataaatcca       360
     gtaaagcatg gttgggtaaa gcaagtgagt gattggccat tctcaacgtt ccatcgcgat       420
     gtcgcgcgag ggttatatcc catcgattgg gcgggggacg taacggattt tagtgccggg       480
     gagcgtatca tttcataa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page