(data stored in ACNUC7421 zone)

EMBL: CP000948.YAFP

CP000948.YAFP        Location/Qualifiers
FT   CDS_pept        226813..227265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafP"
FT                   /locus_tag="ECDH10B_0216"
FT                   /product="predicted acyltransferase with acyl-CoA
FT                   N-acyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01403"
FT                   /protein_id="ACB01403.1"
FT                   /translation="MNNIQIRNYQPGDFQQLCAIFIRAVTMTASQHYSPQQISAWAQID
FT                   ESRWKEKLAKSQVWVAIINAQPVGFISRIEHYIDMLFVDPEYTRRGVASALLKPLIKSE
FT                   SELTVDASITAKPFFERYGFQTVKQQRVECRGAWFTNFYMRYKPQH"
     atgaataaca tacaaataag aaactatcag cctggcgatt ttcagcaact atgcgctatt        60
     ttcattagag cggttacgat gaccgccagt cagcattatt caccacaaca aatttccgcc       120
     tgggcgcaga ttgacgaatc tcgctggaag gagaaactcg cgaaatcaca agtgtgggtt       180
     gcgatcatta atgcacaacc ggttggtttt atttcccgca ttgaacatta tatcgatatg       240
     ttatttgttg accctgaata cacccgccgt ggggttgcca gcgctttgtt aaaacctttg       300
     attaagtctg aatccgaact tacggtggac gcaagcataa ccgcaaaacc cttttttgaa       360
     cgttatggtt ttcagacagt taagcagcag cgcgttgaat gccggggagc gtggtttact       420
     aatttttata tgcgatataa accgcaacat taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page