(data stored in ACNUC7421 zone)

EMBL: CP000948.YAFX

CP000948.YAFX        Location/Qualifiers
FT   CDS_pept        complement(238076..238534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafX"
FT                   /locus_tag="ECDH10B_0231"
FT                   /product="CP4-6 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01415"
FT                   /protein_id="ACB01415.1"
FT                   /translation="MTTQTQHDLAPANQPEFELTVTPVPDEQRIDFWPQYFGAIPQWLL
FT                   LEPHIFAWMDRFCEGYSGGIWSFYTLSNGGAFMSPEPDNDETWRLFNCLNGNDAQMSAE
FT                   AAGIAVCLIAYSHHACRTECDAMTAHYYRLREYAMQHPEAHAILRIID"
     atgacaacac agacgcagca cgacctcgca cccgctaacc aacccgaatt tgaactgacc        60
     gtcacgccgg tccccgatga acagcgtatc gatttctggc cacagtactt tggcgctatc       120
     ccgcagtggc tactcctgga gccgcatatc ttcgcctgga tggaccgctt ctgtgagggc       180
     tacagcggtg gtatctggtc gttctacacc ctcagcaatg gcggcgcatt tatgtccccc       240
     gagcctgaca acgatgagac atggcgtctg tttaactgcc tgaacggtaa cgatgcccaa       300
     atgagtgcag aagcagcagg tattgctgtc tgcctgattg cgtatagcca ccatgcctgc       360
     cgtacagaat gtgacgcgat gaccgcacac tattaccgcc tgcgggagta tgccatgcaa       420
     catccagagg ctcacgccat tctgcgtatt atcgactga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page