(data stored in ACNUC7421 zone)

EMBL: CP000948.YAFZ

CP000948.YAFZ        Location/Qualifiers
FT   CDS_pept        complement(240512..241333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafZ"
FT                   /locus_tag="ECDH10B_0237"
FT                   /product="CP4-6 prophage; conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01419"
FT                   /protein_id="ACB01419.1"
FT                   /translation="MTRLASRFGAANLIRRDRPLTREELFRVVPSVFSEDKHESRSERY
FT                   TYIPTISLLDSLQREGFQPFFACQTRVRDPGRREHTKHMLRLRREGQITGKQVPEIILL
FT                   NSHDGTSSYQMLPGLFRAVCQNGLVCGESFGEVRVPHKGDVVSQVIEGAYEVLGIFDRV
FT                   EEKRDAMQSLLLPPPAQQALAKAALTYRFGEDHQPVTESQILSPRRWQDESNDLWTTYQ
FT                   RIQENLIKGGLSGRNAKGGRSHTRAVRGIDGDVKLNRALWVMAEALLTQLQ"
     atgacccgtc tggcttcgcg ctttggcgca gcaaacctta tccgtcgcga ccgtccgtta        60
     acccgtgaag agctgtttcg cgtagtgccc agtgtattca gtgaggacaa acacgagtcc       120
     cgtagtgagc gttataccta tatacccacc atctccctgc tcgacagcct acagcgagaa       180
     ggcttccagc cattctttgc ctgtcagacc cgcgtgcgtg acccgggtcg tcgtgaacat       240
     acaaagcata tgctgcgtct gcggcgggaa gggcagatca ccggtaaaca ggtgccggaa       300
     attattctac tcaactctca cgatggaacc agttcgtatc agatgttgcc gggactattt       360
     cgtgcggttt gtcagaacgg gctcgtctgc ggtgagtcgt ttggcgaggt gcgggtgcca       420
     cacaaggggg acgtggtgag tcaggtgatt gaaggcgcgt atgaggtgct ggggattttt       480
     gaccgggtgg aggagaaacg ggatgccatg cagtcgttgc tgttgccacc cccggcacag       540
     caggcactgg caaaagccgc cctcacatac cgctttggtg aagaccacca gccggtgact       600
     gaatcgcaga tcctctcccc tcgccgctgg caggatgaga gcaatgacct gtggaccacg       660
     taccagcgta ttcaggagaa cctgattaag ggcgggctca gtggccgtaa tgccaaagga       720
     ggacggtcac atacccgtgc cgttcgcggt atcgacgggg acgtgaaact taaccgggca       780
     ctgtgggtga tggcggaagc cctgctcacg caactgcagt ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page