(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGB

CP000948.YAGB        Location/Qualifiers
FT   CDS_pept        complement(253713..254063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagB"
FT                   /locus_tag="ECDH10B_0253"
FT                   /product="CP4-6 prophage; conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01433"
FT                   /protein_id="ACB01433.1"
FT                   /translation="MNKDSTQTWGLKRDITPCFGARLVQEGHRLHFLADRAGFTGSFSE
FT                   VQTLQLDEAFPHFVAHLELMLLSCELNPRYAHCVTLYRNGLTGEADTLGSHGYVYIAIL
FT                   NRHGFNRHLRVI"
     atgaataaag actctactca aacttggggg cttaaacgag atatcacacc gtgtttcgga        60
     gcacgactgg tgcaggaagg tcatcgtctg cattttctgg ctgaccgggc tggattcacc       120
     ggctcattca gtgaggtgca gactctacaa ctggatgaag ccttcccgca ttttgtcgca       180
     catctggagc tgatgctgct ctcctgtgag ctgaatccca ggtacgcgca ctgtgtcaca       240
     ctgtaccgta acgggctgac tggtgaagcc gatacgctgg gcagtcatgg gtatgtatat       300
     atcgcaattt tgaatcgcca cgggtttaac agacacctcc gagtcattta a                351
//

If you have problems or comments...

PBIL Back to PBIL home page