(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGJ

CP000948.YAGJ        Location/Qualifiers
FT   CDS_pept        266274..267005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagJ"
FT                   /locus_tag="ECDH10B_0264"
FT                   /product="CP4-6 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01442"
FT                   /protein_id="ACB01442.1"
FT                   /translation="MEARVTVAGMGLVMEVQDYFDGEADRLAKAWLAEYTPQIKSLKDE
FT                   RKEAYRQIVEMSTEPQDVDLVRPANKFEMTRVREGEKEADLPVWKHHLLCDESGNYPAL
FT                   LNHWETKVFEIETKREGFAFWYRNPQYTGQSSLGIAYVEAEQYKIVRPDFLFFAEQDGK
FT                   MVVDLVDPHSLHLADALPKLEGLALYAEHHSDAYRRIESVAEVKGKLRVLDLKRQDVQD
FT                   AVATAENAETLFSSGLADDYQ"
     atggaggctc gtgttaccgt tgctggcatg gggctggtga tggaggtgca ggattacttc        60
     gatggcgagg ccgatagact ggcgaaggcg tggctggccg agtacacacc gcaaatcaag       120
     tcgttgaaag atgagcgtaa agaggcctat cgtcaaatcg tcgaaatgag taccgaaccg       180
     caggatgtgg atctggtcag gccggcgaac aagtttgaaa tgaccagggt gcgtgaaggt       240
     gaaaaggaag ctgaccttcc agtctggaaa caccatttgt tgtgtgacga aagcgggaac       300
     tatccggctc tgttgaacca ttgggaaacc aaggtttttg agatcgaaac caaacgtgaa       360
     ggatttgctt tctggtatcg taatccacag tacacagggc agtcgtcact gggaatcgct       420
     tatgttgaag ctgaacagta caagattgtt cgtcccgatt tcctgttctt tgccgaacag       480
     gatggcaaaa tggttgtgga cctggtagat ccacatagcc tacatctggc tgatgctttg       540
     cccaaactgg aaggacttgc gctatatgcc gaacatcatt ctgatgctta caggcgaatc       600
     gaatctgtcg ccgaagtaaa gggtaaatta cgagtgttag atttgaaacg gcaggatgtg       660
     caggatgctg ttgctaccgc tgaaaatgca gaaacgttat ttagtagcgg acttgctgat       720
     gactatcagt aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page