(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGK

CP000948.YAGK        Location/Qualifiers
FT   CDS_pept        complement(267096..267722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagK"
FT                   /locus_tag="ECDH10B_0265"
FT                   /product="CP4-6 prophage; conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01443"
FT                   /protein_id="ACB01443.1"
FT                   /translation="MKTYQGTHGVHILEYQSKINKLLCYLTNRYPRLIAVRVDLHYPKI
FT                   VDNGDNICCFPNLEPGVISRMRESLRAKLEADRTRKVREDKRIYRCPLFIIWAKEYSES
FT                   GKCHYHICLLFNKDAYYHLGDYDQDDNLRGMITGAWYSALRLERDDHPGLVHFPENCKY
FT                   VLDTNSTDFQQNYQALLTRLDYLTKVESKVFGEGDRNFGCSQIEL"
     atgaaaacat atcaaggtac tcatggagta catatcctcg aatatcagag taagattaat        60
     aaattattat gttatttgac taaccggtat cctaggttaa ttgctgtacg tgtcgatctc       120
     cactatccca aaatagttga taacggtgac aatatctgtt gcttccctaa cctggaacct       180
     ggggtgatat cccggatgcg tgaatccctc agagctaagc tggaggctga ccgtacccgt       240
     aaggtgcgtg aggataaacg catttaccgt tgccctttat ttattatatg ggcgaaagag       300
     tattctgaat caggtaaatg ccactatcac atttgcctgt tgttcaacaa agacgcttac       360
     taccacctcg gggattacga tcaggacgat aaccttagag ggatgatcac aggagcctgg       420
     tacagcgccc tgagactgga gagagacgat caccctggtc tggtccattt tcctgaaaac       480
     tgtaagtatg tgctagacac caatagtact gacttccagc agaactacca ggcgctgtta       540
     acccgactgg actacctgac caaagttgaa agcaaagtgt ttggtgaagg agaccgtaac       600
     ttcggctgta gccaaatcga actgtaa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page