(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGL

CP000948.YAGL        Location/Qualifiers
FT   CDS_pept        complement(267994..268692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagL"
FT                   /locus_tag="ECDH10B_0266"
FT                   /product="CP4-6 prophage; DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01444"
FT                   /protein_id="ACB01444.1"
FT                   /translation="MRGKILLYQLKYRWQSLSIFGCFLCKMTLFRYQKIIYDTGVHQMR
FT                   SFFYTICSSEQQESITDHHSLAEICQKFNILPEHVVIEQVDIKEVVSEQRLLRQLIHHE
FT                   MNRQDTLVIPDLSCLGRTVEDLQNILFFCLQKEMFIYSYHPASRIEPSAESCLSFLIAR
FT                   QDTIDIHNLKSTKSRYRHVKKKLGRKEGSKYRRDITILKKGGFTQAEIAKKLSISLSTV
FT                   KRHWNNGIIG"
     atgagaggta aaatactact ttaccagtta aagtatcgct ggcaatcact ctctattttt        60
     ggttgttttt tatgcaaaat gacattattc aggtatcaaa aaataattta tgacaccgga       120
     gtgcatcaga tgcgttcatt tttttacacc atatgcagta gcgaacagca agaaagcatt       180
     acagatcatc actcacttgc tgagatatgc caaaaattta atattctacc tgaacatgtt       240
     gtgatcgagc aggtagatat taaagaggtt gtttcagagc aacgtttact cagacaattg       300
     attcatcatg aaatgaaccg gcaggacacg cttgtcattc cagatctaag ctgtcttggc       360
     agaactgtgg aggacttaca gaatatttta tttttttgcc ttcaaaaaga aatgtttatc       420
     tacagctacc atccagcttc aaggatagag ccttctgctg aaagttgctt gtcttttttg       480
     attgctcgtc aggatacgat tgacattcac aatctgaaat caactaaaag ccgatatcga       540
     catgttaaga aaaaattagg acgaaaggag ggaagcaaat accgacgtga tatcacaata       600
     cttaagaaag gtggatttac tcaggctgag attgcaaaga aattgagtat cagtttatcg       660
     actgtgaagc ggcactggaa taacggaatc atcggttaa                              699
//

If you have problems or comments...

PBIL Back to PBIL home page