(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGM

CP000948.YAGM        Location/Qualifiers
FT   CDS_pept        complement(268719..269573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagM"
FT                   /locus_tag="ECDH10B_0267"
FT                   /product="CP4-6 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01445"
FT                   /protein_id="ACB01445.1"
FT                   /translation="MSNSVTNFEMSSVLPGKKPCQGKNNESQVVQTTPIKKHSVTFKNQ
FT                   SSLGVIDHYARLTNKSHSSVIAEVVDLAIPILEKCNRHNWSINEIKNDLLKFSIKESIN
FT                   RSRGKTEVTLEEYCSLIWKTNIMSPLKIPIADYFQLNANDEFMGKDEKTVIRERLSSLR
FT                   ENYDMEKAIYIYNQRHFDVKHQSVSGYSNIILIHRTTFEGYYFDAGQALLLSTSQLIIF
FT                   GINEVLRRKGIVMPYPVVCWIDIYHVNEMVVMLPVLRKTDVSNRVNVPDDIIINPYSQE
FT                   SRT"
     atgtctaata gtgttactaa ttttgagatg agcagcgttc taccaggaaa aaaaccttgt        60
     caaggcaaaa acaatgagtc acaggtagta cagactactc ccataaaaaa acactcagtc       120
     acgttcaaaa atcaatcttc attaggagta attgatcatt atgccagact aacaaataaa       180
     tctcactctt ccgtaatagc ggaagttgtg gatttggcta tccctatatt agaaaaatgc       240
     aatcgtcata actggtcaat aaatgaaata aaaaatgacc tgttaaagtt ctctataaaa       300
     gaaagcatca atcgaagccg aggtaaaaca gaagtaactc tggaagagta ctgttcgtta       360
     atctggaaaa cgaacatcat gagtccatta aaaatcccca ttgcagatta ctttcaactg       420
     aacgctaatg atgaattcat ggggaaagat gaaaaaacag ttatacgtga aaggctatcc       480
     tcgctaaggg aaaattacga tatggaaaaa gccatttaca tttacaatca aagacatttt       540
     gatgtaaagc atcaaagtgt ctcaggatat tcaaacatta ttcttattca tagaacaacc       600
     tttgagggtt attactttga tgccgggcag gctctactct tgtcaacatc ccaattgatt       660
     atattcggga taaatgaagt tcttagaaga aaggggattg ttatgcctta tccggttgtt       720
     tgttggattg atatttacca tgtcaatgaa atggtggtta tgctgccagt gctccgcaaa       780
     acagatgttt ccaaccgtgt taatgtaccg gatgacatca ttataaaccc atactcacaa       840
     gagagcagaa cctaa                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page