(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGN

CP000948.YAGN        Location/Qualifiers
FT   CDS_pept        complement(269913..270353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagN"
FT                   /locus_tag="ECDH10B_0268"
FT                   /product="CP4-6 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01446"
FT                   /protein_id="ACB01446.1"
FT                   /translation="MATPATVSIEPTLAAIRARWCINSSKTTQSFNDPASMEEVVEYLK
FT                   GTYSALRKSVACAKLKILHLKQRMQNATNFLARLMSCKNQASRSHHSTAKSAKSALSSD
FT                   SGDGSDPDPEPETFPSAFITTPTNSIMLKAFFANISITEVAK"
     atggcaaccc cagcaactgt atccatagaa cccactctgg cagctatcag agctcgctgg        60
     tgtattaatt caagtaaaac aactcaatcc tttaacgatc ctgcgtccat ggaagaggtt       120
     gtcgagtatc tcaaaggaac atactcagct cttcgcaagt ctgtcgcatg cgccaaactg       180
     aaaattttac atcttaaaca aagaatgcaa aatgctacta actttctcgc gcgtctgatg       240
     tcatgtaaaa atcaggcatc cagatcgcat cacagtacgg ctaaatcagc taaaagtgcc       300
     ttatcatcag attcaggtga tggtagtgac cccgaccccg agcccgaaac gtttccttct       360
     gccttcatta ctacccctac taattcaata atgcttaaag ctttctttgc caatatctca       420
     atcactgagg tggcaaaatg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page