(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGQ

CP000948.YAGQ        Location/Qualifiers
FT   CDS_pept        complement(272544..273500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagQ"
FT                   /locus_tag="ECDH10B_0271"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01449"
FT                   /protein_id="ACB01449.1"
FT                   /translation="MSYPLFDKDEHWHKPEQAFLTDDHRTILRFAVEALMSGKGAVLVT
FT                   LVEIRGGAARPLGAQMVVREDGRYCGFVSGGCVEAAAAFEALEMMGSGRDREIRYGEGS
FT                   PWFDIVLPCGGGITLTLHKLRSAQPLLAVLNRLEQRKPVGLRYDPQAQSLVCLPTQTRT
FT                   GWNLNGFEVGFRPCVRLMIYGRSLEAQATASLAAATGYDSHIFDLFPASASAQIDTDTA
FT                   VILLCHDLNRELPVLQAAREAKPFYLGALGSYRTHTLRLQKLHELGWSREETTQIRAPV
FT                   GIFPKARDAHTLALSVLAEVASVRLHQEEDSCLPPSS"
     atgtcatacc cgctttttga caaagacgaa cactggcata agccagagca ggcgtttctc        60
     accgatgacc accggaccat tctgcgcttc gccgtagagg cgctaatgtc cggtaaagga       120
     gcggtgctgg tgacgctggt ggagatacgc ggcggcgcgg cgcgcccgct cggggcgcag       180
     atggtggtgc gcgaagatgg tcgttactgc ggttttgtct ctggcggctg cgtggaggcc       240
     gctgccgctt ttgaagcgct ggagatgatg ggctcaggcc gcgatcgcga aattcgctat       300
     ggcgaaggtt cgccgtggtt tgacatcgtt ctgccctgcg gcggtgggat cacgctgacg       360
     ctccataaac tacgctcggc acagcctctg ctcgccgtgc tgaaccgcct ggaacagaga       420
     aaaccggtgg ggctgcgcta cgatccgcaa gcacaatcgc tggtgtgcct gcccacgcaa       480
     acccggacgg gctggaatct caatggcttt gaggtggggt tcaggccatg cgtcaggctg       540
     atgatttacg gacgttctct tgaggcgcag gcaaccgcga gtcttgcagc agccacaggc       600
     tatgacagcc atatcttcga tctttttccg gcctcagcca gcgctcagat cgataccgat       660
     acggcggtca ttttgctgtg ccatgatctc aaccgggagc tgccagtgtt gcaggccgcg       720
     cgagaagcaa aaccctttta tctcggcgca ttgggcagct atcgaaccca cacgttacgt       780
     ctgcaaaagc tccacgagct gggatggtcc agggaggaaa caacgcaaat ccgggcaccc       840
     gtcgggatat tccccaaagc ccgggatgcg catactctgg cactctccgt gctggcagaa       900
     gtcgcctctg tacgtctcca tcaggaggag gattcatgcc tgcccccgtc gtcctga          957
//

If you have problems or comments...

PBIL Back to PBIL home page