(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGS

CP000948.YAGS        Location/Qualifiers
FT   CDS_pept        complement(275705..276661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagS"
FT                   /locus_tag="ECDH10B_0273"
FT                   /product="predicted oxidoreductase with FAD-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01451"
FT                   /protein_id="ACB01451.1"
FT                   /translation="MKAFTYERVNTPAEAALSAQRVPGAKFIAGGTNLLDLMKLEIETP
FT                   THLIDVNGLGLDKIEVTDAGGLRIGALVRNTDLAAHERVRRDYAVLSRALLAGASGQLR
FT                   NQATTAGNLLQRTRCPYFYDTNQPCNKRLPGSGCAALEGFSRQHAVVGVSEACIATHPS
FT                   DMAVAMRLLDAVVETITPEGKTRSITLADFYHPPGKTPHIETALLPGELIVAVTLPPPL
FT                   GGKHIYRKVRDRASYAFALVSVAAIIQPDGSGRVALGGVAHKPWRIEAADAQLSQGAQA
FT                   VYDTLFASAHPTAENTFKLLLAKRTLASVLAEARAQA"
     atgaaggcgt ttacctatga acgagtgaat accccagccg aggcggcact tagcgctcag        60
     cgcgtacccg gcgcaaaatt tatcgcgggc gggaccaatc tgctggacct gatgaagctg       120
     gaaattgaaa cgcccaccca ccttatcgat gtgaacggcc tcgggctcga taagattgaa       180
     gtgaccgacg cgggtgggct gcgcatcggc gcactggtac ggaacaccga cctggcggct       240
     cacgagcgcg tgcgtcgtga ttacgcggta ctctcccgcg ccctgctcgc tggcgcgtct       300
     ggtcagttac gtaatcaggc aaccaccgca ggtaatctgc tccagcgcac gcgctgcccc       360
     tatttttacg acaccaatca gccctgcaat aagcgcctgc ccgggagcgg ctgcgcggcg       420
     cttgaaggct ttagccgtca gcacgcggtg gtaggcgtaa gcgaagcctg cattgccacc       480
     catccgagcg atatggcggt cgcaatgcgg ttgctggatg cggtggtgga aaccatcacg       540
     ccggagggaa agactcgcag tatcacactg gctgattttt atcaccctcc gggaaaaacg       600
     ccgcacattg aaaccgccct gcttcccggt gagcttatcg ttgcggtgac gttacctcca       660
     ccgctcggcg gaaaacatat ctaccgtaag gtgcgcgatc gcgcctccta cgcctttgcc       720
     ctggtatcgg tcgcggcgat tattcagcct gacggcagcg ggcgcgtcgc gctgggcgga       780
     gtagcacata agccctggcg cattgaggct gcggatgctc agctatccca gggggcgcag       840
     gccgtatatg acacgctgtt cgccagcgcc catcccaccg ctgaaaacac ctttaaactc       900
     ctgttggcga agcgaacgct tgcctccgta ctggctgaag cgagggcaca ggcatga          957
//

If you have problems or comments...

PBIL Back to PBIL home page