(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGT

CP000948.YAGT        Location/Qualifiers
FT   CDS_pept        complement(276658..277347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagT"
FT                   /locus_tag="ECDH10B_0274"
FT                   /product="predicted xanthine dehydrogenase, 2Fe-2S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01452"
FT                   /protein_id="ACB01452.1"
FT                   /translation="MSNQGEYPEDNRVGKHEPHDLSLTRRDLIKVSAATAATAVVYPHS
FT                   TLAASVPAATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDTLRENLHLIGTKKGCDHGQC
FT                   GACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTS
FT                   GQICSSVAVLKEIQDGIPSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIED
FT                   AAGEIKS"
     atgagcaacc aaggcgaata ccccgaagat aatcgggttg ggaagcacga gccgcacgat        60
     ttaagtttga cccgtcgcga tctgattaaa gtgagcgccg caacagcggc gaccgccgtg       120
     gtttatcctc attctacgct ggcggcaagc gttccggcag ctacacccgc gccagagata       180
     atgcccctga cactgaaggt gaacggcaaa accgagcagc ttgaggtgga tacccgaacc       240
     acgctactgg acactttgcg tgaaaatctg catttgatcg gtaccaagaa aggttgcgat       300
     cacggacagt gcggagcctg taccgtgctg gtcaatggtc gcaggcttaa tgcctgcctg       360
     acgcttgcag tcatgcatca gggggccgag atcaccacca ttgaaggcct gggttcgcca       420
     gataatcttc accccatgca ggcggccttt atcaagcatg atggcttcca gtgcggctac       480
     tgcacctccg ggcaaatttg ctcatcagta gcggtgctaa aagagattca ggacggcatt       540
     cccagtcacg tcacggtcga tttggtttcc gctccagaaa caactgccga tgagatccgt       600
     gaacgtatga gcggcaacat ctgtcgctgt ggtgcatacg ctaacatcct tgccgccatt       660
     gaagatgctg cgggggagat aaaatcatga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page