(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGU

CP000948.YAGU        Location/Qualifiers
FT   CDS_pept        277765..278379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagU"
FT                   /locus_tag="ECDH10B_0275"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01453"
FT                   /protein_id="ACB01453.1"
FT                   /translation="MNIFEQTPPNRRRYGLAAFIGLIAGVVSAFVKWGAEVPLPPRSPV
FT                   DMFNAACGPESLIRAAGQIDCSRNFLNPPYIFLRDWLGLTDPNAAVYTFAGHVFNWVGV
FT                   THIIFSIVFAVGYCVVAEVFPKIKLWQGLLAGALAQLFVHMISFPLMGLTPPLFDLPWY
FT                   ENVSEIFGHLVWFWSIEIIRRDLRNRITHEPDPEIPLGSNR"
     atgaatatat ttgaacaaac tccaccgaac cgcagacgtt atggtcttgc tgcattcatt        60
     gggctgattg ctggcgttgt ttccgcattc gtgaagtggg gggctgaagt tccattgccg       120
     ccacgtagcc cggtggatat gtttaatgca gcgtgtggcc cggaatcatt aatcagggct       180
     gcaggccaaa ttgattgctc gcgtaatttt ctcaatccac cgtatatttt tcttcgagac       240
     tggttggggc tgacagatcc caatgcggct gtttatacct ttgccgggca tgtctttaac       300
     tgggttggtg ttacgcacat tatcttttcg atagtgtttg ctgtcggtta ttgtgtggtc       360
     gctgaagtat ttccaaaaat taaactctgg cagggcttac tggcaggtgc tttagcccaa       420
     ctttttgttc atatgatttc attccctctc atgggactga cgccacctct gtttgatctc       480
     ccgtggtatg agaatgtttc tgaaattttt ggacatttag tctggttctg gtctattgaa       540
     attattcgca gagatttacg aaacagaatt actcatgagc cagaccctga gatcccttta       600
     ggctcaaaca gataa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page