(data stored in ACNUC7421 zone)

EMBL: CP000948.YAGV

CP000948.YAGV        Location/Qualifiers
FT   CDS_pept        complement(279269..279979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagV"
FT                   /locus_tag="ECDH10B_0277"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01455"
FT                   /protein_id="ACB01455.1"
FT                   /translation="MFRRRGVTLTKALLTAVCMLAAPLTQAISVGNLTFSLPSETDFVS
FT                   KRVVNNNKSARIYRIAISAIDSPGSSELRTRPVDGELLFAPRQLALQAGESEYFKFYYH
FT                   GPRDNRERYYRVSFREVPTRNHTRRSPTGGVVSTEPVVVMDTILVVRPRQVQFKWSFDK
FT                   VTGTVSNTGNTWFKLLIKPGCDSTEEEGDAWYLRPGDVVHQPELRQPGNHYLVYNDKFI
FT                   KISDSCPAKPPSAD"
     atgttcaggc gacgtggcgt aacattaact aaggccctgc tgacagcggt ctgtatgctg        60
     gcggcacctt tgacacaggc gatttcggtc ggcaatctga cattttcgct gccgtccgag       120
     actgactttg tcagcaaacg tgtagtgaat aacaacaaaa gcgcacggat ataccgtatt       180
     gccatcagtg ctattgatag cccgggcagc agtgaattgc gcacccgacc ggtggatggt       240
     gaactgcttt tcgccccccg ccagctggcg ttgcaggctg gtgagagcga gtattttaaa       300
     ttttactatc atggtccacg ggataaccgc gagcgctact accgggtctc atttcgcgag       360
     gtccccactc gtaaccatac aagacgcagc ccaaccggcg gcgtggtcag cacggagccg       420
     gtggtggtga tggataccat tctggtagta cgaccacgtc aggttcagtt taaatggtcc       480
     ttcgacaagg tgacaggaac ggtaagtaac actggcaaca catggtttaa gctactgatt       540
     aagccaggat gtgattcgac cgaagaggaa ggcgatgcct ggtatctacg tccgggagac       600
     gtggttcatc agcctgagtt acgtcagccg gggaatcact atctggtcta taacgacaaa       660
     ttcattaaga ttagcgattc ctgtccggct aagccccctt cggcggacta a                711
//

If you have problems or comments...

PBIL Back to PBIL home page