(data stored in ACNUC7421 zone)

EMBL: CP000948.YAHE

CP000948.YAHE        Location/Qualifiers
FT   CDS_pept        310699..311562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahE"
FT                   /locus_tag="ECDH10B_0306"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01484"
FT                   /protein_id="ACB01484.1"
FT                   /translation="MWALTADADFLAQRGQGQVEQVFARAVNIALPARQQLLTLLCEEY
FT                   DNAPNSCRLALTHFDDLFRHGDKVQFDDQGITVGQHLHIEMSRCRRWLSPTLQMTAVNF
FT                   HLIAWLQWHDIIHQHLGENETLFNYRGDNPFYQALNKELHIKRRAVIQAVNDKQNIASA
FT                   VASMMGLGIGLTPSADDYLTGLALILFIPGHPAEKYKEEFYLGLQRGKNNTTLLSAITL
FT                   EAALQQRCRENIHRFIHNIIYDIPGNATQAIEKIKHIGSSSGCDMLYGMADGCALSQTY
FT                   GGNYVS"
     gtgtgggcgc taactgcgga tgcggatttt ctggcgcagc gggggcaagg acaggttgaa        60
     caggtctttg ccagagcggt aaatatcgca ctcccggctc gccagcagtt gctgacgctg       120
     ctttgtgaag agtacgacaa tgcgccaaac agttgtcggt tggcactcac tcactttgat       180
     gatctgttcc ggcatggtga taaggttcag tttgacgatc aaggtattac ggttggtcaa       240
     catcttcata tagagatgag tcgttgtcgg cgttggctgt ccccaacctt gcaaatgacc       300
     gctgtgaatt ttcaccttat cgcctggcta cagtggcacg acattattca tcagcacctg       360
     ggggaaaatg aaaccctgtt taattatcgc ggcgataatc cgttttatca ggcgttaaat       420
     aaagaattac atattaaacg acgggcagtt attcaggccg taaacgataa acaaaatatc       480
     gcctcagcgg tcgccagtat gatggggtta gggattggcc ttacgccatc agccgacgat       540
     tatttaacag gtctggcgct tattttattt attcccgggc atccggcgga aaaatacaaa       600
     gaggaatttt atctcggtct gcaacgcggc aaaaataata ccacattatt aagtgccata       660
     acgctggaag ccgcattaca acaacgctgc cgggaaaata ttcatcgttt tattcacaac       720
     attatttatg acatccctgg gaacgcaact caggcaatag aaaaaattaa acatattggc       780
     tccagttccg gctgcgacat gctgtatggc atggccgatg gttgtgcgct gagccaaacc       840
     tacggaggga attatgtcag ttaa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page