(data stored in ACNUC7421 zone)

EMBL: CP000948.YAHF

CP000948.YAHF        Location/Qualifiers
FT   CDS_pept        311552..313099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahF"
FT                   /locus_tag="ECDH10B_0307"
FT                   /product="predicted acyl-CoA synthetase with NAD(P)-binding
FT                   domain and succinyl-CoA synthetase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01485"
FT                   /protein_id="ACB01485.1"
FT                   /translation="MSVKIVIKPNTYFDSVSLMSISTRANKLDGVEQAFVAMATEMNKG
FT                   VLKNLGLLTPELEQAKNGDLMIVINGKSGADNEQLLVEIEELFNTKAQSGSHEARYATI
FT                   GSAKKHIPESNLAVISVNGLFAAREARQALQNDLNVMLFSDNVSVEDELALKQLAHEKG
FT                   LLMMGPDCGTAIINGAALCFGNAVRRGNIGIVGASGTGSQELSVRIHEFGGGVSQLIGT
FT                   GGRDLSEKIGGLMMLDAIGMLENDPQTEIIALISKPPAPAVARKVLERARACRKPVVVC
FT                   FLDRGETPVDEQGLQFARGTKEAALKAVMLSGVKQENLDLHTLNQPLIADVRARLQPQQ
FT                   KYIRGLFCGGTLCDETMFAVMEKHGDVYSNIQPDPEFRLKDINRSIKHTFLDFGDDDFT
FT                   NGKPHPMIDPTNRISRLIEEARDPEVAVIVMDFVLGFGSHEDPVGSTIETIKEAKAIAA
FT                   AEGRELIILAYVLGTDLDTPSLEQQSQMLLDAGVILASSSTNTGLLAREFICKGEEA"
     atgtcagtta aaatagtcat taaaccgaat acctattttg attctgtctc gctgatgtct        60
     atctccacgc gtgcaaataa actcgacggc gtcgagcagg catttgtggc gatggcgacc       120
     gaaatgaata aaggcgtgct gaagaattta ggactgctga cgccggagct ggagcaggcg       180
     aaaaacggcg acctgatgat tgtcatcaat ggtaaatcgg gtgcggacaa cgagcagtta       240
     ctggtggaga ttgaagaact gttcaacacc aaagcgcaaa gcggctcgca cgaggcgcgt       300
     tacgccacta ttggcagcgc caaaaagcat atcccggaaa gtaacctggc ggtgatttcg       360
     gtcaacggtc tgtttgccgc tcgcgaagcg cgtcaggcgc tgcaaaacga tctcaacgtg       420
     atgctgtttt ccgataacgt ctcagttgaa gatgaactgg cgctcaagca actggcccac       480
     gaaaaagggc tgctgatgat ggggccagac tgtggcacgg cgattatcaa cggcgcggcg       540
     ctctgttttg gtaacgccgt gcgtcgcggc aacatcggta ttgttggcgc atccggcacc       600
     ggcagtcagg agttgagcgt ccgcattcat gaatttggcg gcggcgtttc gcaactgatt       660
     ggcaccggcg ggcgcgacct gagcgagaaa atcggcggcc tgatgatgct cgacgccatc       720
     gggatgctgg aaaacgatcc gcaaactgaa atcattgcgc ttatctccaa accgcctgcg       780
     cctgcggtgg cccgcaaagt gctggaacgt gcgcgcgcct gccgcaagcc ggtggtcgtc       840
     tgcttcctcg atcgtggcga aacgccagtg gatgagcagg ggctacagtt tgcccgcggc       900
     accaaagagg cagcgctaaa agcggtgatg ctctccggcg tgaaacagga aaatctcgac       960
     ctgcatacgc ttaaccagcc gttgattgcg gatgtgcgtg cgcgtctgca accgcagcag      1020
     aaatacattc gtggcctgtt ctgcggcggc acgctgtgcg acgaaaccat gttcgcggtg      1080
     atggaaaaac atggcgatgt ctacagcaac attcagcccg atccggaatt ccgcctgaaa      1140
     gatatcaacc gcagcatcaa acacaccttc ctcgactttg gcgatgacga cttcaccaat      1200
     ggcaagccgc acccgatgat tgaccccacc aaccgcatca gtcgcttgat cgaagaggcg      1260
     cgcgatccag aagtggcggt gatcgtgatg gattttgtgc tcggatttgg atcgcatgaa      1320
     gatccggtcg gctccaccat cgagacgatc aaagaagcga aagcgatcgc cgctgccgaa      1380
     ggacgcgagt tgatcattct cgcctatgtg ctgggtaccg atcttgatac gccatcgtta      1440
     gaacaacaaa gccagatgct gcttgatgcc ggagtgattc tggcgagcag cagcaccaat      1500
     accggattgc tggcgcgtga atttatctgc aaaggggagg aagcctga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page