(data stored in ACNUC7421 zone)

EMBL: CP000948.YAIA

CP000948.YAIA        Location/Qualifiers
FT   CDS_pept        345534..345725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiA"
FT                   /locus_tag="ECDH10B_0346"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01518"
FT                   /protein_id="ACB01518.1"
FT                   /translation="MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHP
FT                   TAQEAMDAKKRYEDPDKE"
     atgccaacga aaccgcctta tcctcgtgaa gcatatatag tgacgattga aaaaggaaag        60
     ccaggacaga cggtaacctg gtaccaactc agagccgatc atcctaaacc agactcgttg       120
     atcagtgaac atccgaccgc tcaggaagcg atggatgcga aaaaacgcta tgaggaccct       180
     gacaaagagt ga                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page