(data stored in ACNUC7421 zone)

EMBL: CP000948.YAIE

CP000948.YAIE        Location/Qualifiers
FT   CDS_pept        346732..347016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiE"
FT                   /locus_tag="ECDH10B_0348"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01520"
FT                   /db_xref="GOA:B1XEY0"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XEY0"
FT                   /protein_id="ACB01520.1"
FT                   /translation="MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGEYTFSTAEPEEM
FT                   TVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVAEPTSYLCRYL"
     atgcttcaaa gtaatgagta cttttccggc aaagtgaaat caatcggctt ttccagcagc        60
     agcactggtc gcgccagcgt gggtgttatg gttgaaggcg aatacacctt cagcaccgct       120
     gagccggaag agatgacggt aatcagtggc gcgctgaatg tgttactgcc tgacgcgacc       180
     gactggcagg tgtatgaagc cggttcggtg tttaatgttc ccggtcacag tgagtttcat       240
     ctgcaagttg ccgaacccac ctcttatctg tgccgctatc tgtaa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page