(data stored in ACNUC7421 zone)

EMBL: CP000948.YAIO

CP000948.YAIO        Location/Qualifiers
FT   CDS_pept        complement(318624..319397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiO"
FT                   /locus_tag="ECDH10B_0313"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01491"
FT                   /protein_id="ACB01491.1"
FT                   /translation="MIKRTLLAAAIFSALPAYAGLTSITAGYDFTDYSGDHGNRNLAYA
FT                   ELVAKVENATLLFNLSQGRRDYETEHFNATRGQGAVWYKWNNWLTTRTGIAFADNTPVF
FT                   ARQDFRQDINLALLPKTLFTTGYRYTKYYDDVEVDAWQGGVSLYTGPVITSYRYTHYDS
FT                   SDAGGSYSNMISVRLNDPRGTGYTQLWLSRGTGAYTYDWTPETRYGSMKSVSLQRIQPL
FT                   TEQLNLGLTAGKVWYDTPTDDFNGLQLAARLTWKF"
     atgataaaac ggacgttatt agcggcggcc atttttagcg cattgcccgc ttatgccggg        60
     ttaacttcca ttaccgcggg ctacgatttt accgattatt ctggcgatca tggcaaccgt       120
     aatttagcgt atgctgaact ggtggcgaaa gttgaaaacg caacgctgct ttttaatctt       180
     tcccaggggc gtcgtgatta tgaaactgaa catttcaatg ccactcgcgg tcagggtgcg       240
     gtctggtata aatggaataa ctggctgaca acccgaacgg gtattgcctt tgcggataat       300
     acgccggtct ttgcccgcca ggattttcgt caggatatta acctggccct gttaccaaaa       360
     acgcttttca cgaccggtta tcgctacact aaatattacg atgatgtcga agtcgatgcc       420
     tggcaaggcg gcgtatcact ctatactggc ccggtgatca ccagctaccg ctatacccat       480
     tatgactcca gcgatgcagg tggtagttat agcaatatga tttccgtgcg tctgaatgac       540
     ccgcgcggca ctggttatac gcaactatgg ctaagccgcg gaacaggtgc ttacacctat       600
     gactggacgc cagaaacacg ctacggcagc atgaagagcg tcagtctgca acgtattcaa       660
     ccgctgactg agcaacttaa tctcgggctg acggcaggta aagtgtggta cgacacccca       720
     accgatgatt ttaacggtct gcaacttgca gcccgtctga cctggaaatt ctga             774
//

If you have problems or comments...

PBIL Back to PBIL home page