(data stored in ACNUC7421 zone)

EMBL: CP000948.YAIS

CP000948.YAIS        Location/Qualifiers
FT   CDS_pept        complement(322614..323171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiS"
FT                   /locus_tag="ECDH10B_0320"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01495"
FT                   /protein_id="ACB01495.1"
FT                   /translation="MDKVLDSALLSSANKRKGILAIGAHPDDIELGCGASLARLAQKGI
FT                   YIAAVVMTTGNSGTDGIIDRHEESRNALKILGCHQTIHLNFADTRAHLQLNDMISALED
FT                   IIKNQIPSDVEIMRVYTMHDADRHQDHLAVYQASMVACRTIPQILGYETPSTWLSFMPQ
FT                   VFESVKEEYFTVKLAALKKHKS"
     gtggataagg ttttagattc agccctcctt tcttcggcaa ataaaagaaa gggtatcctt        60
     gctattggcg cacatcctga cgatatagaa ttaggctgtg gcgcatcgct tgctcgtctt       120
     gcgcaaaaag gaatttatat cgcagccgtg gtgatgacta ccggcaactc tggcacagat       180
     ggaataatcg atcgccatga agaatcgcgc aacgccctaa agatattagg gtgccaccaa       240
     actattcatc ttaattttgc tgacacccgc gctcatttac agctcaatga tatgatttcc       300
     gccctggaag acatcattaa aaatcaaatt ccttctgatg ttgaaatcat gcgggtatat       360
     accatgcatg atgccgaccg ccatcaggat catcttgctg tttatcaagc ttcaatggtt       420
     gcctgccgaa ctattccgca aattctcggc tacgaaaccc caagtacctg gctttcattt       480
     atgcctcagg tttttgaatc cgttaaagaa gaatatttca cagtcaaact tgctgcatta       540
     aaaaaacata aaagctag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page