(data stored in ACNUC7421 zone)

EMBL: CP000948.YAJL

CP000948.YAJL        Location/Qualifiers
FT   CDS_pept        complement(381606..382196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajL"
FT                   /locus_tag="ECDH10B_0380"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01552"
FT                   /protein_id="ACB01552.1"
FT                   /translation="MSASALVCLAPGSEETEAVTTIDLLVRGGIKVTTASVASDGNLAI
FT                   TCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIVAA
FT                   ICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWLDKRVVWDARVKLLTSQGPGTAID
FT                   FGLKIIDLLVGREKAHEVASQLVMAAGIYNYYE"
     atgagcgcat cggcactggt ttgcctcgcc cctggtagtg aagagactga agccgtcacc        60
     actatcgatc tgctggttcg cggcggtatc aaagtcacca ctgccagcgt cgccagcgat       120
     ggtaacctgg cgattacctg ctcgcgcggc gtgaagctgc tggcggatgc gccgctggtc       180
     gaagtggctg atggcgaata tgacgtgatc gtgctgcctg gtggcattaa aggcgcggag       240
     tgttttcgcg atagcactct gctggttgaa accgttaaac agttccaccg ttccgggcgt       300
     atcgtcgcgg ctatttgcgc cgcgccagcc accgtgctgg tgccgcacga tatcttcccg       360
     attggtaata tgaccggctt cccgacgctg aaagacaaaa ttcccgccga acaatggctg       420
     gacaagcgcg tcgtctggga tgcacgggta aaattgctga ccagccaggg gccgggtaca       480
     gctatcgact ttggtctgaa aattatcgac ctgttggttg ggcgtgaaaa agcccatgaa       540
     gtggcatcac aactggtgat ggcggcaggg atttataatt attacgagta g                591
//

If you have problems or comments...

PBIL Back to PBIL home page