(data stored in ACNUC7421 zone)

EMBL: CP000948.YBAE

CP000948.YBAE        Location/Qualifiers
FT   CDS_pept        complement(404167..405867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaE"
FT                   /locus_tag="ECDH10B_0401"
FT                   /product="predicted transporter subunit:
FT                   periplasmic-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01573"
FT                   /protein_id="ACB01573.1"
FT                   /translation="MRLLNRLNQYQRLWQPSAGKPQTVTVSELAERCFCSERHVRTLLR
FT                   QAQEAGWLEWQAQSGRGKRGQLRFLVTPESLRNAMMEQALETGKQQDVLELAQLAPGEL
FT                   RTLLQPFMGGQWQNDTPTLRIPYYRPLEPLQPGFLPGRAEQHLAGQIFSGLTRFDNNTQ
FT                   RPIGDLAHHWETSTDGLRWDFYLRSTLHWHNGDAVKASHLHQRLLMLLQLPALDQLFIS
FT                   VKRIEVTHPQCLTFFLHRPDYWLAHRLASYCSHLAHPQFPLIGTGPFRLTQFTAELVRL
FT                   ESHDYYHLRHPLLKAVEYWITPPLFEKDLGTSCRHPVQITIGKPEELQRVSQVSSGISL
FT                   GFCYLTLRKSPRLSLWQARKVISIIHQSGLLQTLEVGENLITASHALLPGWTIPHWQVP
FT                   DEVKLPKTLTLVYHLPIELHTMAERLQATLAAEGCELTIIFHNAKNWDDTTLQAHADLM
FT                   MGDRLIGEAPEYTLEQWLRCDPLWPHVFDAPAYAHLQSTLDAVQIMPDEENRFNALKAV
FT                   FSQLMTDATLTPLFNYHYRISAPPGVNGVRLTPRGWFEFTEAWLPAPSQ"
     atgcgattgc tcaaccgtct taaccagtat caacgtctgt ggcaaccttc cgccggaaag        60
     ccgcaaaccg tcaccgtcag cgaactggcc gaacgctgtt tttgcagcga acgccatgtt       120
     cgtacgctgt tgcgtcaggc acaggaggcg ggatggctgg agtggcaggc gcagtcagga       180
     cgcggaaagc gcggacaatt acgctttctg gtcacgccgg aatcgctacg caatgcgatg       240
     atggaacagg cactggaaac cggaaagcag caagatgtgc tggagctggc gcaactggcc       300
     ccaggtgagc tgcgcactct gttacagccg tttatgggcg gacaatggca aaacgataca       360
     cccacgttgc gtattcccta ctatcgcccg ctcgaaccgc tacaaccagg ctttttgccc       420
     ggccgtgccg agcagcatct cgccgggcag atattttccg gcctgacccg cttcgataat       480
     aatactcagc gcccgattgg cgatttagcg catcactggg aaacctctac tgacgggtta       540
     cgctgggact tttatcttcg ttcaacccta cactggcata acggcgatgc agtaaaagcc       600
     tcacacttac accagcgatt attgatgctg ttacaactgc cagcactgga tcaattattt       660
     attagcgtga agcgtattga agtcacccat ccgcagtgtc tgaccttctt tttacatcgc       720
     cctgattact ggcttgcgca ccggctggcg agctattgca gccatctggc gcatccgcaa       780
     ttcccactga tcggcacggg tccttttcgc ttaacacaat tcacagcaga gctggtgcgc       840
     ctggaaagcc atgattatta ccatttacgt catccgctgc ttaaagcggt tgagtactgg       900
     ataactccgc cgcttttcga aaaagatttg ggaaccagtt gtcggcatcc cgtgcaaatc       960
     accatcggca aaccggagga gctgcaacgg gtcagccagg tcagtagcgg catcagttta      1020
     ggtttttgct atttgacgtt gcgcaaaagt ccccgactct ccctctggca ggcgcgaaaa      1080
     gtgatctcca ttattcatca atccggttta ttacaaacgt tagaagtcgg agaaaacctg      1140
     atcaccgcca gtcatgcatt actgccaggc tggactattc cgcattggca ggtaccggat      1200
     gaagtcaaac taccgaaaac cttgacgctg gtttatcacc taccgataga acttcatacc      1260
     atggcagaac gcctacaggc gacactggca gcggaaggct gtgaactcac aattattttt      1320
     cataacgcaa aaaactggga cgacacgacc ctacaggcac acgcagacct catgatgggc      1380
     gacagattaa ttggcgaagc accggaatat actctggagc aatggctgcg ctgcgatccg      1440
     ctgtggccac atgttttcga cgctccagca tacgcacatc tacaatcgac actggatgcc      1500
     gtgcaaataa tgcctgatga agaaaaccga tttaatgccc tgaaagcggt ttttagccag      1560
     ttaatgacag atgcgacgct gacgccgctg ttcaactatc actatcgcat tagtgcccct      1620
     cccggcgtga acggtgtgcg actgacaccg cgcggctggt ttgaatttac cgaagcctgg      1680
     cttcccgcgc catcgcaatg a                                                1701
//

If you have problems or comments...

PBIL Back to PBIL home page