(data stored in ACNUC7421 zone)

EMBL: CP000948.YBAP

CP000948.YBAP        Location/Qualifiers
FT   CDS_pept        complement(445841..446635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaP"
FT                   /locus_tag="ECDH10B_0439"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01609"
FT                   /protein_id="ACB01609.1"
FT                   /translation="MDLLYRVKTLWAALRGNHYTWPAIDITLPGNRHFHLIGSIHMGSH
FT                   DMAPLPTRLLKKLKNADALIVEADVSTSDTPFANLPACEALEERISEEQLQNLQHISQE
FT                   MGISPSLFSTQPLWQIAMVLQATQAQKLGLRAEYGIDYQLLQAAKQQHKPVIELEGAEN
FT                   QIAMLLQLPDKGLALLDDTLTHWHTNARLLQQMMSWWLNAPPQNNDITLPNTFSQSLYD
FT                   VLMHQRNLAWRDKLRAMPPGRYVVAVGALHLYGEGNLPQMLR"
     atggatctgt tgtaccgggt aaaaacgctt tgggccgcgc tgcgcggtaa tcattacacc        60
     tggcctgcca tcgatatcac cctccccggc aatcgccatt ttcatctgat tggcagtatt       120
     catatgggta gccacgatat ggctcccctg cccacccgtt tgctcaaaaa gctcaaaaac       180
     gccgatgcgc tgatcgtcga ggcggatgtt tccaccagcg atacgccttt tgctaatttg       240
     cctgcctgcg aggcgctgga agagcgcatt agcgaggagc aactccaaaa cctgcagcac       300
     attagccagg agatgggcat ttctccctca ctcttttcta cccaaccgct gtggcaaatc       360
     gcgatggttc ttcaggcgac gcaggcacaa aaactggggc tgcgggcaga atacggtatc       420
     gattaccagc tattgcaggc ggcgaagcaa caacataaac ccgtgattga actggaaggg       480
     gctgaaaacc agattgccat gttgctccag ctccctgaca aaggactggc gctgctggac       540
     gatacgctga cccactggca taccaacgca cggttgctgc aacaaatgat gagctggtgg       600
     ctgaatgcac cgccgcaaaa taatgatata acgctgccca atacgttcag tcagtcgctg       660
     tacgatgtgc tgatgcatca gcgaaatctc gcctggcggg ataaattacg cgccatgccg       720
     ccggggcgat atgtggtcgc ggtcggtgca ctacacctgt atggagaagg gaatttgccg       780
     caaatgttgc gctaa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page