(data stored in ACNUC7421 zone)

EMBL: CP000948.YBAV

CP000948.YBAV        Location/Qualifiers
FT   CDS_pept        402492..402863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="ECDH10B_0398"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01570"
FT                   /protein_id="ACB01570.1"
FT                   /translation="MKHGIKALLITLSLACAGMSHSALAAASVAKPTAVETKAEAPAAQ
FT                   SKAAVPAKASDEEGTRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLK
FT                   QVPGMGNSLVERNLAVLTL"
     atgaaacacg gaattaaagc actgctcatt accctgtccc tggcctgtgc cggaatgtct        60
     catagcgcgc tggcggcagc ttctgtggcg aaaccgacgg cggtagaaac caaagcggaa       120
     gctcctgcag cacaaagtaa agcagcagta ccggcgaaag ccagtgacga agaaggcacc       180
     cgggtcagca ttaataatgc cagcgcggaa gagctagccc gcgcgatgaa tggcgttggc       240
     ctgaagaaag cgcaggcgat tgtcagttat cgcgaagagt acggtccgtt taaaactgtg       300
     gaggatctaa agcaggtgcc ggggatgggc aattcgctgg tggaacgtaa tctggcggta       360
     ttaaccctgt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page