(data stored in ACNUC7421 zone)

EMBL: CP000948.YBAW

CP000948.YBAW        Location/Qualifiers
FT   CDS_pept        402957..403355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaW"
FT                   /locus_tag="ECDH10B_0399"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01571"
FT                   /protein_id="ACB01571.1"
FT                   /translation="MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSDSFQWMT
FT                   AHNIAFVVVNININYRRPAVLSDLLTITSQLQQLNGKSGILSQVITLEPEGQVVADALI
FT                   TFVCIDLKTQKALALEGELREKLEQMVK"
     atgcaaacac aaatcaaagt tcgtggatat catctcgacg tttaccagca cgtcaacaac        60
     gcccgctacc ttgaatttct cgaagaagcc cgctgggatg ggttggaaaa tagcgacagt       120
     tttcagtgga tgacggccca taacatcgcc ttcgtcgtgg tcaatatcaa tattaactat       180
     cgtcgcccag cggtattaag tgacctgtta actattacca gtcagttgca gcaattaaac       240
     ggtaaaagcg gcatcttaag ccaggtcatt acactggagc cggaagggca ggtggtagcg       300
     gatgcgctta ttacgtttgt ttgtattgat cttaaaacgc agaaagcatt agctctggaa       360
     ggggaattgc gcgaaaagct ggagcagatg gttaagtaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page